Align D-serine/D-alanine/glycine transporter (characterized, see rationale)
to candidate WP_008508798.1 BIBO1_RS14845 amino acid permease
Query= uniprot:A0A0C4YRF7 (472 letters) >NCBI__GCF_000182725.1:WP_008508798.1 Length = 467 Score = 416 bits (1069), Expect = e-121 Identities = 206/444 (46%), Positives = 297/444 (66%), Gaps = 4/444 (0%) Query: 15 EEKDLHRGLKDRHIQMIAIGGAIGVGLFLGAGRAIAIAGPGLMLSYAIGGVAIFFIMRAL 74 EE L R L +RH+Q+IAIGG IG GLF+G+G+A+++AGP ++L YAI G +FF+MRAL Sbjct: 15 EEPHLARNLSNRHLQLIAIGGTIGTGLFMGSGKAVSLAGPSILLIYAITGFMLFFVMRAL 74 Query: 75 GELLLYRPVSGSFATYAEEFVGPFAGFATGWSYWFMWVVTGMAEITAVAVYVHYWFPDVP 134 GE+LL SFA +A +++GP A F TGW+YW W+VT +AE+ AV+ YV +WFP + Sbjct: 75 GEILLSNLQYRSFADFAGDYLGPCAQFFTGWTYWLCWIVTAVAEVVAVSGYVSFWFPHLA 134 Query: 135 QWIPALATLAVLYLVNCVAVAVFGELEFWFALIKVVTIVAMIVIGLAIIFFG-VTPLGPT 193 WIPAL + +L ++N V FGE+EFWFALIK++TI+ +I+ G+ ++ G V P G Sbjct: 135 PWIPALGLITILLILNLPTVRNFGEIEFWFALIKIITIIGLIITGIYMLMTGFVLPNGTQ 194 Query: 194 ASFSNLWTHGGFMPFGTLGVVLTLQIVMFAYQGVELIGVTAGEAQNPEKVLPHATNGVVW 253 AS ++LW HGGF P G+LG + QI +FA+ G+EL+G A EA+NP + LP A N + Sbjct: 195 ASIAHLWNHGGFFPNGSLGFIAGFQISVFAFVGIELVGTAAAEAENPMRNLPKAINNIPI 254 Query: 254 RILIFYVGALIIMMALVPWNELKPGVSPFVYVFERIGVPGAAAIVNLVVITAAASSCNSG 313 RI++FY+GAL +++ + PWN++ P SPFV +F G+ AA +N VV+T+A+SS NSG Sbjct: 255 RIVLFYIGALFVIITVTPWNQVDPNSSPFVAMFSLAGIGIAAHFINFVVLTSASSSSNSG 314 Query: 314 IFSTGRMLYTLAQFGQAPRAFGRVSSKHVPSIAITFSAALMGIGVLLNYIVPE--QVFVW 371 I+ST RM+Y LA G AP+AF ++S++ VP A+ FS + V+L Y QVF Sbjct: 315 IYSTSRMVYGLATVGLAPKAFSKLSNRKVPVHALIFSCIFLLSSVVLLYAGQSMIQVFTL 374 Query: 372 VTSISLVGSLWTWSIIMIAHLGYRKAIAAGRVKAVAFRMPGAPYANWLVVAFMIAVAVLL 431 VT+IS + ++ WSII++++L YR+ K+ F+MPG + +V F V L Sbjct: 375 VTTISALLFIFIWSIILVSYLQYRRKHPERHEKS-TFKMPGGRASVVMVFVFFAFVLWAL 433 Query: 432 SLDPGTRVALYVAPVWFALLGIGY 455 + +P T A+ V P+WF LLGI Y Sbjct: 434 TQEPDTLAAMKVTPLWFVLLGIAY 457 Lambda K H 0.328 0.142 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 714 Number of extensions: 40 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 467 Length adjustment: 33 Effective length of query: 439 Effective length of database: 434 Effective search space: 190526 Effective search space used: 190526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory