Align GtsC (GLcG), component of Glucose porter, GtsABCD (characterized)
to candidate WP_008510538.1 BIBO1_RS17480 carbohydrate ABC transporter permease
Query= TCDB::Q88P36 (281 letters) >NCBI__GCF_000182725.1:WP_008510538.1 Length = 279 Score = 126 bits (316), Expect = 6e-34 Identities = 78/267 (29%), Positives = 133/267 (49%), Gaps = 4/267 (1%) Query: 17 IHAVLLIAVLLYLVPLVVMLLTSFKTPEDITTGNL-LSWPAVITGIGW--VKAWGAVSGY 73 +HA L+ +L+ + P+ + L+ SFK+ I L L P + IG+ V G+ Y Sbjct: 14 VHATLIFYMLIAVFPVALTLINSFKSRNAIFREPLRLPTPESFSLIGYETVLKQGSFLTY 73 Query: 74 FWNSIMITVPAVLISTAIGALNGYVLSMWRFRGSQLFFGLLLFGCFLPFQTVLLPASFTL 133 F NS ++TV ++ + GA+ + L+ +RFRG+ L L G +P + + + Sbjct: 74 FQNSAIVTVVSIFLVILFGAMAAFALAEYRFRGNMLTGLYLAIGIMIPIRLGTVALLQGM 133 Query: 134 GKLGLASTTGGLVLVHVVYGLAFTTLFFRNFYVSIPDALVKAARLDGAGFFTIFRRIILP 193 GL +T L+LV+ GL F ++ D L A R+DG + IF +++LP Sbjct: 134 VAAGLVNTLTALILVYTAQGLPLAIFILSEFMRTVSDDLKNAGRIDGMSEYAIFFKLVLP 193 Query: 194 MSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVNTSTGAKEYNVDMAAAM 253 + P + ++ IWND F ++ + ++ TV L + +N +AA Sbjct: 194 LIRPAMATVAVFTMIPIWNDLWFPLILAPSEATK-TVTLGAQLFIGQFVTNWNAVLAALS 252 Query: 254 IAGLPTLLVYVVAGKYFVRGLTAGAVK 280 +A P L++YV+ + +RG+TAGAVK Sbjct: 253 LAMFPILILYVLFSRQLIRGITAGAVK 279 Lambda K H 0.329 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 279 Length adjustment: 26 Effective length of query: 255 Effective length of database: 253 Effective search space: 64515 Effective search space used: 64515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory