Align 2-ketogluconokinase (EC 2.7.1.13) (characterized)
to candidate WP_008510314.1 BIBO1_RS16980 5-dehydro-2-deoxygluconokinase
Query= metacyc::MONOMER-12748 (320 letters) >NCBI__GCF_000182725.1:WP_008510314.1 Length = 634 Score = 99.0 bits (245), Expect = 3e-25 Identities = 91/325 (28%), Positives = 144/325 (44%), Gaps = 25/325 (7%) Query: 4 IDILSFGETMA-MFVAEHGGDLAQVQHFHKRIAGADSNVAIGLARLGFKVAWLSRVGNDS 62 +D+++ G + ++ A+ GG L + F+K + G+ +N+A G ARLG + A ++RVG++ Sbjct: 5 LDLITIGRSSVDLYGAQIGGLLEDMASFNKYVGGSPTNIATGTARLGLRSALITRVGDEH 64 Query: 63 LGRFVLDTLRAEGLDCRFVRCDPIHPTGFQLKSREDGGDDPRVEYFRRGSAASHLAISDL 122 +GRF+L L EG+D R + DP T + D P + ++R A L D+ Sbjct: 65 MGRFLLRELEREGVDTRGIVTDPERLTALVILGIRDQQHFPLI-FYRENCADMALCEDDI 123 Query: 123 DPALL-RARHLHATGIPPALSDSARELSG-HLMHTQRSAGHSVSFDPNLRPALWP----- 175 DP + AR + ATG LS E + +H R G + D + RP LW Sbjct: 124 DPDFIAEARCVLATG--THLSHPRTEAAVLKALHLARENGSRTALDIDYRPNLWGLSGHG 181 Query: 176 -------SEALMIREINRLAALAHWVLPGLAEGRLLTGRDDPADIAAFYLDQGAEAVVIK 228 A + ++ L ++ E + G D + A+V K Sbjct: 182 DGENRFIESAAVTAKLQSTLPLFDLIVGTEEEFHIAGGSTDTLEALKAVRRVTKAALVCK 241 Query: 229 LGAHGAY-----YRTQLDAG-FVEGVPVAQVVDTVGAGDGFAVGLISALLESRGILEAVQ 282 G GA LD G +G P+ +V + +GAGDGF GL+ L+ +++ Sbjct: 242 RGPMGAVVFEGDIPDDLDKGQSGQGFPI-EVFNVLGAGDGFMSGLLRGWLKGEDWPTSLK 300 Query: 283 RANWIGSRAVQSRGDMEGLPLRHEL 307 AN G+ AV G P EL Sbjct: 301 FANACGAFAVSRHGCTPAYPSWEEL 325 Lambda K H 0.321 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 514 Number of extensions: 35 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 634 Length adjustment: 33 Effective length of query: 287 Effective length of database: 601 Effective search space: 172487 Effective search space used: 172487 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory