Align ABC transporter for D-Trehalose, permease component 2 (characterized)
to candidate WP_008509834.1 BIBO1_RS16195 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b20327 (276 letters) >NCBI__GCF_000182725.1:WP_008509834.1 Length = 275 Score = 478 bits (1230), Expect = e-140 Identities = 240/275 (87%), Positives = 262/275 (95%) Query: 2 VVAIAKRTAFYALVAVIILVAVFPFYYAILTSLKSGTALFRIDYWPTDISLANYAGIFSH 61 ++ KR+AFY LVA+IILVAVFPFYYAI+TS KSGTALF++DYWP +SL NY G+ + Sbjct: 1 MMRFVKRSAFYLLVALIILVAVFPFYYAIITSFKSGTALFQVDYWPKSLSLDNYTGVLTQ 60 Query: 62 GTFVRNLGNSLLVATLVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVLA 121 G+FVR+LGNSLLVAT+VVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVLA Sbjct: 61 GSFVRSLGNSLLVATVVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVLA 120 Query: 122 GLFELIRFVGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGASPWVVI 181 GLFELIRF+GIFNTPLAL+FSYMIF+LPFTVWVLTTFMRDLP+EIEEAAIVDGASPWV+I Sbjct: 121 GLFELIRFLGIFNTPLALVFSYMIFSLPFTVWVLTTFMRDLPVEIEEAAIVDGASPWVII 180 Query: 182 TRVFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIALLSGGSQFEIPWG 241 TRVFMPLMWPALVTTGLLAFI+AWNEFLFALTFTSS +QRTVPVAIALLSG SQFEIPWG Sbjct: 181 TRVFMPLMWPALVTTGLLAFISAWNEFLFALTFTSSGSQRTVPVAIALLSGSSQFEIPWG 240 Query: 242 NIMAASVIVTVPLVVLVLIFQRRIISGLTAGGVKG 276 NIMAASVIVTVPLV+LVLIFQRRI+SGLTAGGVKG Sbjct: 241 NIMAASVIVTVPLVILVLIFQRRIVSGLTAGGVKG 275 Lambda K H 0.332 0.143 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 275 Length adjustment: 25 Effective length of query: 251 Effective length of database: 250 Effective search space: 62750 Effective search space used: 62750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory