Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_013444925.1 PALPR_RS07060 dihydrofolate reductase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_000183135.1:WP_013444925.1 Length = 330 Score = 261 bits (667), Expect = 2e-74 Identities = 148/323 (45%), Positives = 208/323 (64%), Gaps = 7/323 (2%) Query: 2 KPKVFITRQIPENGIKMIEKFYEIELWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKEL 61 K +V ++ ++ G +E+ +E+ + + + R +L+ + DA V KVDK++ Sbjct: 13 KKRVLVSTRLLREGFSQLEEHFEVA-FPENEVFSRNEILQLLPSFDAFVPTFQFKVDKDI 71 Query: 62 LE-NAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIV 120 ++ +LKIIA + VGY+NIDI+ A ++ I VTNTP + + TA+ AFAL+LA ARR+ Sbjct: 72 IDAGQDRLKIIANFGVGYNNIDIDYACRKNILVTNTPDPVIEPTAEQAFALMLAAARRVA 131 Query: 121 EADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYYS 180 E D +R K + W L LG L GKT+GIVG GRIGQ+LA+RA GMKI+YY+ Sbjct: 132 ECDRKLRL----KDGLKWGVLENLGQTLYGKTIGIVGMGRIGQSLARRALANGMKIVYYN 187 Query: 181 RTRKP-EAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINT 239 RT+ P + E AE+++ + LL SD +SLHVPLT ET+H+I K+L MK AILINT Sbjct: 188 RTKLPLDIENLYQAEWMELDNLLSASDVVSLHVPLTNETFHLIDSKKLARMKTTAILINT 247 Query: 240 SRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEAREG 299 +RG VV+ L+K LK+ I A LDV+E EP N+EL ++ NVVLAPH G+AT EAR Sbjct: 248 ARGPVVNELDLVKVLKDRRIYAAALDVYEFEPIINQELLQMDNVVLAPHNGTATIEARND 307 Query: 300 MAELVAKNLIAFAKGEIPPNLVN 322 MA LV++N+I + G N VN Sbjct: 308 MARLVSQNIIRYFAGRTDINRVN 330 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 330 Length adjustment: 28 Effective length of query: 303 Effective length of database: 302 Effective search space: 91506 Effective search space used: 91506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory