Align isovalerate--CoA ligase (EC 6.2.1.1) (characterized)
to candidate WP_013445999.1 PALPR_RS12485 AMP-binding protein
Query= metacyc::MONOMER-20124 (573 letters) >NCBI__GCF_000183135.1:WP_013445999.1 Length = 549 Score = 177 bits (448), Expect = 1e-48 Identities = 147/548 (26%), Positives = 242/548 (44%), Gaps = 43/548 (7%) Query: 47 FLERSSKAYRDNTSLVYG--SVRYTWAQTHHRCLKLASALTTHLGISPGDVVATFSYNLP 104 +LE + D+ +VY ++R++W+ + R +A L +G++ G V ++ N+P Sbjct: 11 WLEHWAAETPDHEYIVYSDRNLRFSWSAFNERVDNMAKGLLA-VGVTKGCHVGIWAQNVP 69 Query: 105 EIYELHFAVPMAGGILCTLNARNDSAMVSTLLAHSEAKLI----------FVE------P 148 + +A G + T+N ++ +L +S+ + +VE P Sbjct: 70 DWLTFLYACAKLGAVAVTVNTNYKDHELAFVLENSDMHTLCITDGISGSDYVEMVYSLIP 129 Query: 149 QLLETARAALDLLAQKDIKPPTLVLLTDSESFTSSSYDHYNHLLANGSDD----FEIRRP 204 +L R L ++K + + Y+ LL + +I++ Sbjct: 130 ELKTNQRGHLKSERFPELKNVIYI----GQEKHRGMYNTAEVLLLGDNQPNDAFLKIKKS 185 Query: 205 KNEWDPISINYTSGTTARPKAVVYSHRGAYLNSIATVLLHGMGTTSVYLWSVPMFHCNGW 264 + + +++ YTSGTT PK V+ SH N T VP+FHC G Sbjct: 186 VSCHEVVNMQYTSGTTGFPKGVMLSHHNIANNGYLTGEHMKFTQADKLCVCVPLFHCFGV 245 Query: 265 CFP-WGAAAQGATNICIRKVSPKAIFDNIHLHKVTHFGAAPTVLNMIVNSPEGNLHTPLP 323 G T + + K P +IH + T PT+ +N P L Sbjct: 246 VLATMNCLTHGCTQVMVEKFDPLITLASIHKERCTAVYGVPTMFIAELNHPMFELFDMSS 305 Query: 324 HKVEVMTGGSPPPPKVIARMEEMGFQVNHIYGLTETCGPAANCVCKPEWDALQPEERYAL 383 + +M G P + E+M + +YGLTET P + E+ + + Sbjct: 306 LRTGIMAGALCPIELMRQVSEKMFMTITSVYGLTET---------SPGMTQTRLEDSFEV 356 Query: 384 KARQGLNHLAMEEMDVRDPVTMESVRADGATIGEVMFRGNTVMSGYFKDLKATEEAFE-G 442 + + E+ V +P T E + DG GE+ RG VM GY+K+ +AT E + Sbjct: 357 RCTTVGSDYEFTEVAVINPETGE-ICPDGVQ-GEMCCRGYNVMKGYYKNPQATSEVIDKN 414 Query: 443 GWFRSGDLGVKHEDGYIQLKDRKKDVVISGGENISTVEVETVLYSHEAVLEAAVVARPDK 502 G+ RSGDLGVK DG ++ R KD++I GGENIS E+E LY V +A +VA Sbjct: 415 GYLRSGDLGVKDLDGNYRITGRIKDMIIRGGENISPREIEEFLYHMPGVKDAQIVALASP 474 Query: 503 LWGETPCAFVTLKEGFDNDVSADQIIKFCRDRLPHYMAPKTVVF-EELPKTSTGKIQKYI 561 +GE AF+ G+ ++ + + FC+D++ Y P+ V F E P T +GKIQK+ Sbjct: 475 RYGEDVAAFIIQHAGY--QLTLEDVRDFCKDKIARYKIPRYVFFVSEYPLTGSGKIQKFK 532 Query: 562 LKEKAMAM 569 L+E A+ + Sbjct: 533 LREMAIEL 540 Lambda K H 0.318 0.133 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 715 Number of extensions: 37 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 573 Length of database: 549 Length adjustment: 36 Effective length of query: 537 Effective length of database: 513 Effective search space: 275481 Effective search space used: 275481 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory