Align UDP-glucose 4-epimerase (EC 5.1.3.2); UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) (characterized)
to candidate WP_013443943.1 PALPR_RS02055 dTDP-glucose 4,6-dehydratase
Query= BRENDA::Q9WYX9 (309 letters) >NCBI__GCF_000183135.1:WP_013443943.1 Length = 343 Score = 148 bits (373), Expect = 2e-40 Identities = 111/329 (33%), Positives = 172/329 (52%), Gaps = 32/329 (9%) Query: 2 NILVTGGAGFIGSHVVDKLIEN--GYGVIVVDNLS-SGKVENL-----NRNALFYEQSIE 53 +IL+TGGAGFIGSHVV + Y +I +D L+ +G + NL N N F + I Sbjct: 6 HILITGGAGFIGSHVVRLFVNKYPEYKIINLDKLTYAGNLANLKDVEDNANYTFIKGDIC 65 Query: 54 DEEMMERIFSLHRPEYVFHLAAQASVAISVREPARDAKTNIIGSLVLLEKSIK-----YG 108 D + M +F+ ++ + V HLAA++ V S+++P A+TN++G+L LL+ + + Y Sbjct: 66 DFDQMLALFNQYQIDGVIHLAAESHVDRSIKDPFTFAQTNVMGTLSLLQAAKQSWKDAYD 125 Query: 109 VKKFIFSSTGGAIYGE---NVKVFPTPETEIPHPISPYGIAKYSTEMYLEFFAREYGLKY 165 K F ST +YG + ++F ET +P SPY +K S++ ++ F YG+ Sbjct: 126 GKLFYHIST-DEVYGALEMDSELF--TETTNYNPHSPYSASKASSDHFVRAFHDTYGMPV 182 Query: 166 TVLRYANVYGPRQDPYGEAGVVAIFTERMLRGEEVHIFGDGEYVRDYVYVDDVVRANLLA 225 V +N YGP Q P ++ +F + G+ + ++G GE VRD++YV D RA L Sbjct: 183 IVTNCSNNYGPYQFP---EKLIPLFINNIRHGKSLPVYGKGENVRDWLYVVDHARAIDLI 239 Query: 226 MEKGDN-EVFNIGTGRGTT----VNQLFKLLKEITGY-----DKEPVYKPPRKGDVRKSI 275 G E +NIG T + L K L + G+ D Y R G + Sbjct: 240 FHTGKTAETYNIGGFNEWTNIDIIRVLIKTLDRLLGHAEGSSDHLITYVTDRAGHDLRYA 299 Query: 276 LDYTKAKEKLGWEPKVSLEEGLKLTVEYF 304 +D TK K +LGWEP + EEG++ TV ++ Sbjct: 300 IDSTKLKTELGWEPSLQFEEGIEKTVRWY 328 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 343 Length adjustment: 28 Effective length of query: 281 Effective length of database: 315 Effective search space: 88515 Effective search space used: 88515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory