Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_013444478.1 PALPR_RS04750 NAD-dependent epimerase/dehydratase family protein
Query= curated2:A8GWP0 (341 letters) >NCBI__GCF_000183135.1:WP_013444478.1 Length = 339 Score = 454 bits (1167), Expect = e-132 Identities = 224/337 (66%), Positives = 282/337 (83%), Gaps = 5/337 (1%) Query: 1 MFVDKTLLITGGTGSFGNAVLSRFLKNDIIKDIKEIRIFSRDEKKQEDMRIALNNPKIKF 60 +F DK LLITGGTGSFGNAVL+RFL DI KEIRIFSRDEKKQ+DMR NPKI+F Sbjct: 3 IFKDKILLITGGTGSFGNAVLNRFLDTDI----KEIRIFSRDEKKQDDMRHQYQNPKIRF 58 Query: 61 YIGDVRNYNSIDDAMKDVDYVFHAAALKQVPTCEFYPMEAINTNILGAENVLRAATINKV 120 YIGDVR+ S+D AMK VDYVF AAALKQVP+CEF+PM+A+ TN++G ENVL +A + V Sbjct: 59 YIGDVRDKRSVDGAMKGVDYVFAAAALKQVPSCEFFPMQAVRTNVIGTENVLDSAIEHGV 118 Query: 121 AKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMNVRD-KTVFCVTRYGNVMASRGSVI 179 V+VLSTDKA YPINAMG+SKA+MEK+AIAKAR +D KT C TRYGNVMASRGSVI Sbjct: 119 KNVVVLSTDKACYPINAMGISKAMMEKVAIAKARALGKDAKTTICCTRYGNVMASRGSVI 178 Query: 180 PLFINQIKQNKDLTITEPSMTRFLMSLVDSVDLVLYAFEYGHQGDIFVQKSPASTIEVLA 239 PL+++Q++ D+TIT+P+MTR++M+L D+VDLV+YAFE+G GD+FVQK+PA+T++VLA Sbjct: 179 PLWVDQMQAGNDITITDPNMTRYMMTLDDAVDLVIYAFEHGENGDLFVQKAPAATLDVLA 238 Query: 240 KALQGIFNSKNKIRFIGTRHGEKHYESLVSSEEMAKAEDLGNYYRIPMDGRDLNYAKYFV 299 KAL G++ + K+R IGTRHGEK YE+LV+ EEMAK+ED+GNYYRIP D RDLNY KYFV Sbjct: 239 KALIGLYKTNTKVRVIGTRHGEKLYETLVTREEMAKSEDMGNYYRIPCDARDLNYDKYFV 298 Query: 300 EGEKKIALLEDYTSHNTKRLNLEEVKELLLNLDYVQE 336 EGE+K++ +EDY SHNT RL+ E +K+LLL L+++++ Sbjct: 299 EGEEKVSQIEDYHSHNTTRLDEEGMKQLLLKLEFIRD 335 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 339 Length adjustment: 28 Effective length of query: 313 Effective length of database: 311 Effective search space: 97343 Effective search space used: 97343 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory