Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_083807174.1 PALPR_RS04680 polysaccharide biosynthesis protein
Query= curated2:A8GWP0 (341 letters) >NCBI__GCF_000183135.1:WP_083807174.1 Length = 655 Score = 154 bits (388), Expect = 8e-42 Identities = 103/282 (36%), Positives = 155/282 (54%), Gaps = 17/282 (6%) Query: 4 DKTLLITGGTGSFGNAVLSRFLKNDIIKDIKEIRIFSRDEKKQEDMRIAL--NNPKIKFY 61 DK +LITG GS G+ ++ + K + +F E ++R+ + N P++KF Sbjct: 296 DKIILITGAAGSIGSELVRQLAHFKP----KLLLVFDVAETPLHNLRMEMERNYPELKFV 351 Query: 62 --IGDVRNYNSIDDAMKDV--DYVFHAAALKQVPTCEFYPMEAINTNILGAENVLRAATI 117 IGDVR+ N +D + V+HAAA K VP E P EA+ NI G N+ A Sbjct: 352 PIIGDVRSENRLDFVFRKYHPQIVYHAAAYKHVPLMEENPCEAVLVNIKGTMNLSNYAVR 411 Query: 118 NKVAKVIVLSTDKAVYPINAMGLSKALMEKL--AIAKARMNVRDKTVFCVTRYGNVMASR 175 KV +++STDKAV P N MG SK + E A+AK K F TR+GNV+ S Sbjct: 412 YKVESFVMISTDKAVNPTNVMGASKRIAEIYVQALAKETQKNGGKVNFVTTRFGNVLGSN 471 Query: 176 GSVIPLFINQIKQNKDLTITEPSMTRFLMSLVDSVDLVLYAFEYGHQGDIFV--QKSPAS 233 GSVIP F QI++ +T+T P + R+ M++ ++ LVL A +G+ G+I+V SP Sbjct: 472 GSVIPHFKEQIEKGGPVTVTHPDIIRYFMTIPEACRLVLEAASFGNTGEIYVFDMGSPVK 531 Query: 234 TIEVLAKALQ--GIFNSKN-KIRFIGTRHGEKHYESLVSSEE 272 +++ + ++ G +K+ I FIG R GEK +E L++ +E Sbjct: 532 IVDLAKRMIELAGFVPNKDINIEFIGLRPGEKLFEELLNDKE 573 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 655 Length adjustment: 33 Effective length of query: 308 Effective length of database: 622 Effective search space: 191576 Effective search space used: 191576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory