Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate YP_004140309.1 Mesci_1095 beta-ketoadipyl CoA thiolase
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_000185905.1:YP_004140309.1 Length = 401 Score = 239 bits (609), Expect = 1e-67 Identities = 156/413 (37%), Positives = 222/413 (53%), Gaps = 31/413 (7%) Query: 1 MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKR-AGIDPKEVEDVVMGAAMQ 59 M EA I RTPIG+ + G+L++ L + +R GID + ++DVV G A Q Sbjct: 1 MAEAYICDYIRTPIGR-FGGSLSSVRSDDLGAIPLRALAERNPGIDWQAIDDVVYGCANQ 59 Query: 60 QGATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGES 119 G N+AR ALL AGLP G+T++R C SG+ A+ +AAR++ E+ + GG ES Sbjct: 60 AGEDNRNVARMALLLAGLPKEVPGSTVNRLCGSGMDALTIAARAIKAGEAELMIAGGVES 119 Query: 120 ISLVQ----------------NDKMNTFHAVDPALEAIKGDVYMAMLDTAETVAKRYGIS 163 +S D + V+P ++ G +M +T E VA+ + +S Sbjct: 120 MSRAPFVMPKADTAFSRNAEIYDTTIGWRFVNPLMKKQYG--VDSMPETGENVAEDFSVS 177 Query: 164 RERQDEYSLESQRRTAAAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRP 223 R QD +++ SQ + AAQ G+ EI P++ D + +S+DE PR Sbjct: 178 RADQDAFAVRSQNKAVAAQANGRLAKEITPVTILQRKGDA---------LIVSKDEHPRA 228 Query: 224 ETTAEGLAGLKAVRGEGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSY 283 +T E LA L +G T+TAGNAS ++DGA+A ++ S+ GL P+ G + Sbjct: 229 GSTVEALAKLPTPFRQGGTVTAGNASGVNDGAAALIVASEAAVKKYGLTPIARILGGAAA 288 Query: 284 GCEPDEMGIGPVFAVPRLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGI--DPEKLNV 341 G P MGIGPV A +L R GL+ + ELNEAFA Q + +LGI D E +N Sbjct: 289 GVAPRIMGIGPVPATQKLCARLGLTPKQFDVIELNEAFASQGIAVLRQLGIAEDAEHVNP 348 Query: 342 NGGAISVGHPYGMSGARLAGHALIEGRRRKAKYAVVTMCVGGGMGSAGLFEIV 394 NGGAI++GHP GMSGAR++G A +E R R +YA+ TMC+G G G A E V Sbjct: 349 NGGAIALGHPLGMSGARISGTAALELRERGGRYALATMCIGVGQGIAIALERV 401 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 401 Length adjustment: 31 Effective length of query: 364 Effective length of database: 370 Effective search space: 134680 Effective search space used: 134680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory