Align AotP aka AotM aka PA0890, component of Arginine/ornithine (but not lysine) porter (characterized)
to candidate YP_004139543.1 Mesci_0320 polar amino acid ABC transporter inner membrane subunit
Query= TCDB::O50183 (232 letters) >NCBI__GCF_000185905.1:YP_004139543.1 Length = 269 Score = 161 bits (407), Expect = 1e-44 Identities = 87/226 (38%), Positives = 135/226 (59%), Gaps = 8/226 (3%) Query: 5 FSVIWDSLPLYFD----GLLVTLKLLSISLLIGLLLAVPLALMRVSKQPLVNFPAWLYTY 60 F + WD LP Y++ GL +L +L+++ ++G LLAVPL L + + PA ++ Sbjct: 38 FFMRWDWLPQYYEMGLIGLWRSLWILAVTCVLGFLLAVPLGLAQAAGSFWFAAPAKVFCT 97 Query: 61 VIRGTPMLVQLFLIYYGLA----QFDAVRESALWPWLSNASFCACLAFAINTSAYTAEIL 116 VIRGTP+L+QL+L+YYGL Q+ +RES +WP+L A LA ++ + Y E++ Sbjct: 98 VIRGTPLLIQLWLLYYGLGSLFPQYPWIRESWMWPYLRQAWPYGVLALTLSFAGYEGEVM 157 Query: 117 AGSLKATPHGEIEAAKAMGMSRLKMYRRILLPSALRRALPQYSNEVIMMLQTTSLASIVT 176 G+ P G++EAA+A GMSR K +RRI LP A+ RALP + E ++ L++T L + ++ Sbjct: 158 RGAFAGVPKGQLEAARAFGMSRWKAFRRIWLPQAIYRALPTLTGETVLQLKSTPLVATIS 217 Query: 177 LVDITGAARTVYSQYYLPFEAFITAGLFYLCLTFILVRLFKLAERR 222 ++DI + V YL +E + L Y+ +T ILV F E R Sbjct: 218 VIDIFAVSSKVRQDTYLTYEPLLLLALIYMTITGILVFAFSRIEAR 263 Lambda K H 0.330 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 269 Length adjustment: 24 Effective length of query: 208 Effective length of database: 245 Effective search space: 50960 Effective search space used: 50960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory