Align Histidine transport system permease protein HisM (characterized)
to candidate YP_004140529.1 Mesci_1319 polar amino acid ABC transporter inner membrane subunit
Query= SwissProt::P0AEU3 (238 letters) >NCBI__GCF_000185905.1:YP_004140529.1 Length = 226 Score = 124 bits (310), Expect = 2e-33 Identities = 82/226 (36%), Positives = 125/226 (55%), Gaps = 16/226 (7%) Query: 2 IEILHEYWKPLLWTDGYRFTGVAITLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIWL 61 ++++ E LLW + T+ L +LS V+G + L A+ R+ K + + Sbjct: 5 LQLMLESLPSLLWA------ALIFTVPLTLLSFVLGLTVGLGAALARLFGPKPLVALVRF 58 Query: 62 FTYIFRGTPLYVQLLVFYSGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEIF 121 + +IFRGTPL VQL + + G+ ++ I+ L+AF ++ TLN AYT+EI Sbjct: 59 YVWIFRGTPLLVQLFLIFYGLPSVGIL-----LDAF-----TAALIGFTLNIGAYTSEII 108 Query: 122 AGAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTAT 181 AI SVP G+ EAA + G + + R ILP A R+A+P SN I ++ T+LA T Sbjct: 109 RAAIGSVPKGQWEAAYSIGMTWSQAMRRTILPQAGRVAVPPLSNTFISLVKDTSLAAAIT 168 Query: 182 VPDLLKIARDINAATYQPFTAFGIAAVLYLIISYVLISLFRRAEKR 227 VP++ + A+ I A TY+P + AA+LYL +S VL +L R E R Sbjct: 169 VPEMFQAAQRIVATTYEPLILYVEAAILYLALSSVLSALQTRLETR 214 Lambda K H 0.330 0.142 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 226 Length adjustment: 23 Effective length of query: 215 Effective length of database: 203 Effective search space: 43645 Effective search space used: 43645 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory