Align ABC transporter for L-Asparagine and possibly other L-amino acids, permease component 1 (characterized)
to candidate YP_004139790.1 Mesci_0568 polar amino acid ABC transporter inner membrane subunit
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4771 (248 letters) >NCBI__GCF_000185905.1:YP_004139790.1 Length = 218 Score = 101 bits (252), Expect = 1e-26 Identities = 73/205 (35%), Positives = 109/205 (53%), Gaps = 17/205 (8%) Query: 28 GLAWTIGIAIAAWIIALTLGSILGVM--RTVPNRIVSGIATCYVELFRNVPLLVQLFIWY 85 G A TI + IA +A TL SILG R P + IA CYVE+ RN P LVQLF + Sbjct: 16 GAATTI-LLIAVTTLAGTLLSILGAAGRRNGPVLLKRAIA-CYVEVMRNTPFLVQLFFIF 73 Query: 86 FLVPDLLPADLQEWYKQDLNPTTSAFLSVVVCLGLFTTARVCEQVRTGIQALPKGQESAA 145 F +P L L+P +A L++ + + +T E V G+ A+P GQ AA Sbjct: 74 FGLPSL---------GVRLDPLLAAMLAMTLNMAAYTI----EIVGAGLDAVPGGQTEAA 120 Query: 146 RAMGFKLPQIYWNVLLPQAYRIIIPPLTSEFLNVFKNTSVASLIGLMELLAQTKQTAEFS 205 A+G + Q++ ++LPQA +II P LTS+ + + ++V S I + EL + + Sbjct: 121 LALGLRPRQVFVKIVLPQALKIIYPALTSQIVIMMLESAVVSQIAVRELTYEADMLQART 180 Query: 206 ANLFEAFTLATLIYFTLNMSLMLLM 230 FE + + TL+Y L+M+L L+ Sbjct: 181 FRSFETYFVVTLVYLALSMALRRLL 205 Lambda K H 0.326 0.139 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 218 Length adjustment: 23 Effective length of query: 225 Effective length of database: 195 Effective search space: 43875 Effective search space used: 43875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory