Align glutaminase (EC 3.5.1.2) (characterized)
to candidate YP_004142733.1 Mesci_3563 glutaminase, core
Query= BRENDA::P0A6W0 (308 letters) >NCBI__GCF_000185905.1:YP_004142733.1 Length = 315 Score = 263 bits (673), Expect = 3e-75 Identities = 148/310 (47%), Positives = 199/310 (64%), Gaps = 6/310 (1%) Query: 2 AVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQER 61 A +D A+ E + ++ +G VA YIP L VD + GIA T DG++ AGDA + Sbjct: 7 APKLDRALAE-VAAEMAERTDRGDVASYIPQLGKVDPKKFGIAAVTNDGRVLMAGDADQA 65 Query: 62 FSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGAL 121 FSIQSISKV +L +A+ + + +WQRVG++PSG+PFNS+VQLE E GIPRNPFINAGA+ Sbjct: 66 FSIQSISKVFTLTLALGNVGDA-LWQRVGREPSGNPFNSIVQLEHENGIPRNPFINAGAI 124 Query: 122 VVCDMLQGRLSAPRQRMLEVVRGLSGVSD---ISYDTVVARSEFEHSARNAAIAWLMKSF 178 V+ D+L PR+ + E++R + ++D I D VA SE RN A+A MKSF Sbjct: 125 VISDILLAG-HQPREAIGEILRFIQFLADDETIIIDREVAASERATGYRNFALANYMKSF 183 Query: 179 GNFHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALM 238 GN HH L YFH+CA+ MSC +LA FLAN GK VV+ +AR+I A+M Sbjct: 184 GNLHHAPELALGVYFHHCAIAMSCRQLALAGRFLANGGKNPATGHSVVSAERARRIGAMM 243 Query: 239 ATSGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQ 298 T G Y +G+FA+RVG+P KSGVGGGI+ IVP ++AVWSP L+ GNS G LE+ Sbjct: 244 LTCGHYDGSGDFAFRVGIPGKSGVGGGILGIVPGVASLAVWSPGLNANGNSKLGSIALEK 303 Query: 299 LTKQLGRSVY 308 L + + S++ Sbjct: 304 LARMMNWSIF 313 Lambda K H 0.321 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 315 Length adjustment: 27 Effective length of query: 281 Effective length of database: 288 Effective search space: 80928 Effective search space used: 80928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory