Align Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale)
to candidate YP_004139338.1 Mesci_0115 polar amino acid ABC transporter inner membrane subunit
Query= uniprot:Q31RN9 (396 letters) >NCBI__GCF_000185905.1:YP_004139338.1 Length = 224 Score = 115 bits (289), Expect = 9e-31 Identities = 73/210 (34%), Positives = 118/210 (56%), Gaps = 13/210 (6%) Query: 190 GLLLTLATALISMVCSLPLGILLALGRQSSLPAIRWLSVTYIELFRGLPLVTILFFGQVM 249 G L TL ++S+ +P+G+ ++L R + +RWL+V Y ++FR LP++ +L Sbjct: 23 GFLNTLLLGILSIGIGIPIGLGISLVRLYAPKPLRWLAVGYTDIFRALPVLVVLILIYYA 82 Query: 250 VPLMLDSEWRIDRILRAIVGLTIFLSAYLAETVRGGLQAIPQGQFEAAAALGLNLFQTYR 309 +P + R+ A+ +SAY AE R G+++IP+GQFEA+ ALGL T R Sbjct: 83 LPFL---GIRLSSWASAVTAFAFIMSAYSAEVFRSGIESIPRGQFEASQALGLPFLLTLR 139 Query: 310 FIVLPQALRISIPAIVGLFLNLLQDTTLLSIVGLLELL---GISRSILANPAYLGRYAEV 366 +VLPQA+R+ IP + +++ +DT+L S V L ELL ++S+ ANP+ L A V Sbjct: 140 KVVLPQAIRVVIPPMTSNCVSMFKDTSLASTVALPELLKEATNAQSLYANPSPLIGAALV 199 Query: 367 YLFLGVLYWLCCYGLAQLSRRLEQRLTPQR 396 YL + W + +L LE+R ++ Sbjct: 200 YL---IFLW----PMVRLVSLLEERFKTEK 222 Lambda K H 0.329 0.142 0.471 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 224 Length adjustment: 26 Effective length of query: 370 Effective length of database: 198 Effective search space: 73260 Effective search space used: 73260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory