Align citrate lyase β subunit (EC 4.1.3.34) (characterized)
to candidate YP_004134379.1 Mesci_6210 citryl-CoA lyase
Query= metacyc::MONOMER-16999 (289 letters) >NCBI__GCF_000185905.1:YP_004134379.1 Length = 270 Score = 142 bits (357), Expect = 1e-38 Identities = 97/278 (34%), Positives = 153/278 (55%), Gaps = 21/278 (7%) Query: 8 LFIPGANAAMLSTSFVYGADAVMFDLEDAVSLREKDTARLLVYQALQHPLYQDIETVVRI 67 LF+PG+ + + GADAV+ DLEDAV+ +KD AR +V + + VVRI Sbjct: 11 LFVPGSRPERFAKADNSGADAVILDLEDAVAPGDKDRAREVV---VAYAAMLKSAIVVRI 67 Query: 68 NPLNTPFGLADLEAVVRAGVDMVRLPKTDSKEDIHELEAHVERIERECGREVGSTKLMAA 127 N TP+ AD++AV R V LPK + EDI ++ H+ R S ++A Sbjct: 68 NAAGTPWHEADIDAVRRLEGVSVMLPKAERPEDIADMAKHMAR----------SVSVIAL 117 Query: 128 IESALGVVNAVEIARASPRLAAIALAAFDYVMDMGTSRGDGTELFYARCAVLHAARVAGI 187 +ESA+G+ N I A+ + A+A + D+ +D+G + D L AR ++ +R AG Sbjct: 118 VESAVGLANLPAIL-ATSGIVAVAFGSVDFSLDLGCAH-DRLTLLAARNEIVWRSRAAGR 175 Query: 188 AA-YDVVWSDINNEEGFLAEANLAKNLGFNGKSLVNPRQIELLHQVYAPTRKEVDHALEV 246 AA D V +D+++ E +A A +GF GK ++PRQIE + + P+ KE+ A ++ Sbjct: 176 AAPIDGVTTDLSSPEITEDDARHAMKMGFGGKLAIHPRQIEPIRVAFRPSDKEIIWARDI 235 Query: 247 IAAAEEAETRGLGVVSLNGKMIDGPIIDHARKVVALSA 284 + AA E V +NG+M+D P+I+ AR+V+ +A Sbjct: 236 VGAASSGE-----AVQVNGEMVDRPVIERARQVLRRAA 268 Lambda K H 0.319 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 270 Length adjustment: 26 Effective length of query: 263 Effective length of database: 244 Effective search space: 64172 Effective search space used: 64172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory