Align ABC transporter for D-glucosamine, permease component 1 (characterized)
to candidate YP_004140529.1 Mesci_1319 polar amino acid ABC transporter inner membrane subunit
Query= reanno::pseudo3_N2E3:AO353_21715 (220 letters) >NCBI__GCF_000185905.1:YP_004140529.1 Length = 226 Score = 130 bits (327), Expect = 2e-35 Identities = 79/200 (39%), Positives = 112/200 (56%) Query: 17 LLAGLGLGLELALVSIAIGCVIGLLMAFALLSKHRALRVLASVYVTVIRNTPILVLILLI 76 L A L + L L+S +G +GL A A L + L L YV + R TP+LV + LI Sbjct: 16 LWAALIFTVPLTLLSFVLGLTVGLGAALARLFGPKPLVALVRFYVWIFRGTPLLVQLFLI 75 Query: 77 YFALPSLGIRLDKLPSFIITLSLYAGAYLTEVFRGGLLSIPKGLREAGLAIGLGEWQVKA 136 ++ LPS+GI LD + +I +L GAY +E+ R + S+PKG EA +IG+ Q Sbjct: 76 FYGLPSVGILLDAFTAALIGFTLNIGAYTSEIIRAAIGSVPKGQWEAAYSIGMTWSQAMR 135 Query: 137 YVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKINVESYRVIETWLVTTA 196 +P R +P LSN FISL KDTSLAAAI VPE+ A++I +Y + ++ Sbjct: 136 RTILPQAGRVAVPPLSNTFISLVKDTSLAAAITVPEMFQAAQRIVATTYEPLILYVEAAI 195 Query: 197 LYVAACYLIAMLLRYLEQRL 216 LY+A +++ L LE RL Sbjct: 196 LYLALSSVLSALQTRLETRL 215 Lambda K H 0.329 0.143 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 226 Length adjustment: 22 Effective length of query: 198 Effective length of database: 204 Effective search space: 40392 Effective search space used: 40392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory