Align ABC transporter for L-Histidine, permease component 2 (characterized)
to candidate YP_004140063.1 Mesci_0846 binding-protein-dependent transport system inner membrane protein
Query= reanno::acidovorax_3H11:Ac3H11_2561 (252 letters) >NCBI__GCF_000185905.1:YP_004140063.1 Length = 286 Score = 151 bits (382), Expect = 1e-41 Identities = 86/256 (33%), Positives = 139/256 (54%), Gaps = 13/256 (5%) Query: 1 VSARARWMLGLAFFVVFVAVWAFFTLGGFVSPTFLASP-------ITMAKEGWLLFTEYG 53 VSARA + + +V +A+WA VSP FL SP IT+A++G F + Sbjct: 34 VSARA---VSVMTILVVLALWALSARLQLVSPVFLPSPVAVWNKFITVARDG---FVDAT 87 Query: 54 FIKDIGMTIWRVVGGFVLAAVIAVPLGIAMGAYKGIEAFFEPFISFCRYLPASAFIPLLI 113 ++ ++ RV V A ++ VP+G+A+G F+P + F R +P A++PL++ Sbjct: 88 LLQHAIASLGRVFAALVAAILVGVPVGLAIGISTIGRGIFDPLLEFLRPIPPLAYLPLVV 147 Query: 114 LWAGIGEAQKILVIFIGSVFQITLMVAVTVGGARRDLVEAAYTLGAGHKGIVTRVLIPGA 173 +W GIGE KILVI I + + L A V G ++ + AA +LGA + +V V++P A Sbjct: 148 IWFGIGEPSKILVITISMLAPVALSTASGVRGVSQERINAARSLGATQRQVVRHVILPSA 207 Query: 174 APEIAETLRLVLGWAWTYVIVAELIGSSSGIGHMITDSQSLLNTGQIIFGIIIIGLIGLV 233 P I LR+ LG W+ ++ AEL+ ++ G+G MI + L T ++ GI++I I V Sbjct: 208 LPAILTGLRIALGAGWSTLVAAELVAATRGLGFMIQSAAQFLVTDVVVMGILVIAAIAFV 267 Query: 234 SDFAFKALNHRLFAWS 249 +F + + L W+ Sbjct: 268 LEFTLRRIERVLVPWA 283 Lambda K H 0.331 0.145 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 286 Length adjustment: 25 Effective length of query: 227 Effective length of database: 261 Effective search space: 59247 Effective search space used: 59247 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory