Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate YP_004144761.1 Mesci_5619 polar amino acid ABC transporter inner membrane subunit
Query= uniprot:B2TBJ8 (250 letters) >NCBI__GCF_000185905.1:YP_004144761.1 Length = 268 Score = 138 bits (347), Expect = 1e-37 Identities = 79/224 (35%), Positives = 134/224 (59%), Gaps = 6/224 (2%) Query: 5 FDFLFDTIKQLLAAVPTTLGLFFCSLILGGLLSLVI-VTMRVSPHWLPNRFARAYILVFR 63 +D+L D +A + ++ + + + G +L+L + + V P WL + A+A+ V R Sbjct: 41 WDWLADYYMLAIAGLWRSIWILIVTCVFGFVLALPLGLAQVVGPSWL-SLPAKAFCTVIR 99 Query: 64 GSPLLIQMFLVYYGMG----QFGVIRESFLWPVLREPYMCAVLSLALCTAGYTAEIIRGG 119 G+PLL+Q++L+YYG+G Q+ IRES +WP++R+ + AVL+L L AGY E++RG Sbjct: 100 GTPLLLQIWLLYYGLGSLFPQYPWIRESDIWPLVRQAWPYAVLALTLSFAGYVGEVMRGA 159 Query: 120 LMAVPVGQIEAGYSIGLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWE 179 VP GQ+EAG + G++ + L RRV P A+ + LP + E V+ +KST L + +TV + Sbjct: 160 FAGVPSGQLEAGRAFGMNRWKLFRRVWLPQAIHKALPTLAGETVMQLKSTPLVATITVVD 219 Query: 180 VTGVAQQIIQQTYRTTEVFICAALIYLFLNFVIVRLLGMLETRL 223 + V+ ++ Q T E + AL Y+ L ++V + +E R+ Sbjct: 220 LYAVSARVRQDTLVIYEPLLLLALTYMVLTGLLVWIFSRIEARI 263 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 268 Length adjustment: 24 Effective length of query: 226 Effective length of database: 244 Effective search space: 55144 Effective search space used: 55144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory