Align Histidine ammonia-lyase; Histidase; EC 4.3.1.3 (uncharacterized)
to candidate YP_004142202.1 Mesci_3024 phenylalanine/histidine ammonia-lyase
Query= curated2:Q73Q56 (507 letters) >NCBI__GCF_000185905.1:YP_004142202.1 Length = 493 Score = 286 bits (732), Expect = 1e-81 Identities = 174/477 (36%), Positives = 260/477 (54%), Gaps = 5/477 (1%) Query: 6 VTVTGSSLTIEDVVAVARHGAEVKLSADAKKRIKDSKKIVDDIVKSGKPTYGISTGFGEL 65 + +TG+ + + DV AVAR G +V++ D R++ +++++D SG+ YG++TG G Sbjct: 4 LVLTGTGVGVGDVAAVARDGRKVEIGPDVIGRLEKARRVLDQAAASGQQIYGLNTGLGA- 62 Query: 66 STVTITKDQNGALQRNLILSHACGVGNPFPEDIVRAIMLLRLNTHASGFSGVTPSVPDIL 125 + T + GA QR L+ + VG P D VRA M R + G SG++PSV L Sbjct: 63 NLGTAVEGDAGAFQRQLLEGRSGAVGEGLPVDAVRASMAARAAMLSVGGSGLSPSVFVAL 122 Query: 126 VDMLNKGVIPYVPEKGSLGASGDLANLAHIALVMIGEGKAYYEGKLMEGKAALAKAGLKP 185 VD LN GV P +P GS+GA GDL + +A ++ GEG+A Y+G+ + AL A L P Sbjct: 123 VDALNAGVHPVMPSLGSIGA-GDLVLMTALARMLTGEGEADYQGRRIPAAKALMMARLAP 181 Query: 186 VVLSGKDGLGIINGTPVMSGIGALALHDAEQLLKAANMGASLVFEAFRGITAALDPRIHK 245 + L+ KDGL +IN + V +G GALA+ DA L +L E F LDPR+H Sbjct: 182 ISLAPKDGLSLINASAVSAGSGALAVTDALTALAQQQHAGALTIEGFGANRTILDPRLHM 241 Query: 246 SRPHKGQIDTAAFILKMLKGSSSINTRENDVQDPYTLRCVPQVHGASADAIAYVRKVLEI 305 +RP GQ + A + +L + +QDP ++RC+ VHGA +AI R+ +EI Sbjct: 242 ARPAAGQQEAAKVLHNLLVRDDA--PAPTTLQDPLSIRCMSSVHGALIEAIGQARQAVEI 299 Query: 306 EINAVTDNPLVFPDNHDVISGGNFHGQPIAITMDFLGIAVSELANISERRIERLVNPQLN 365 E+NA DNPLV D+ V+S GNFH +A+ + LG+A+++ A R +L N Sbjct: 300 ELNAAADNPLVLGDDELVLSTGNFHTAALALAFETLGLAIAQCAAAGAARFIQLTGSGRN 359 Query: 366 GGLPAFLIENGGVNSGFMIPQYTAASLVSENKVLAHPASVDSITSSGNKEDHVSMGTTAA 425 GLP +L GG ++GF+ Q T S+++ + A+P +D + S EDH + A Sbjct: 360 -GLPKYLSPVGGASAGFVPLQKTVTSILAAIRHKANPVMLDFLAVSEGVEDHATQTPLAV 418 Query: 426 RKITEIVKNVRHVLAIEWLTAAQACDLRGVKKYGKGTGEMMKLIRKHISKVTEDRIL 482 K T ++ R ++A E + AAQA DLR T + IR + + EDR L Sbjct: 419 AKCTGMIALWRRLIAFELMAAAQAIDLRDGFTLAPRTAALHAAIRSLVPMLKEDRPL 475 Lambda K H 0.316 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 507 Length of database: 493 Length adjustment: 34 Effective length of query: 473 Effective length of database: 459 Effective search space: 217107 Effective search space used: 217107 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory