Align acetyl-CoA C-acetyltransferase (subunit 2/2) (EC 2.3.1.9) (characterized)
to candidate YP_004144074.1 Mesci_4919 propanoyl-CoA C-acyltransferase
Query= BRENDA::I3RA72 (383 letters) >NCBI__GCF_000185905.1:YP_004144074.1 Length = 388 Score = 181 bits (459), Expect = 3e-50 Identities = 126/382 (32%), Positives = 200/382 (52%), Gaps = 21/382 (5%) Query: 1 MEVAVIGSSMTKFGQ-RSAWIRELLSEAGQACLEDAGVAPASVDHLYVSNMASGEFEGQ- 58 M ++G + ++FG+ + L+ + L+ AG+ P VD + + + +G F Q Sbjct: 1 MTACIVGWTHSRFGKLEGETLENLIVKVATDALDHAGIGPDEVDEIVLGHFNAG-FSAQD 59 Query: 59 -TGVMNALAHD-LGVIPAYTQRIDQTSSSGGAGIYEAWQSIASGVSEMTLLVGGEKMTHK 116 T + A D L PA R++ ++G A + + ++I + + + L+VG E+MT Sbjct: 60 FTASLVLQADDRLRFKPA--TRVENACATGSAAVRQGIRAIDANAARIVLVVGAEQMTTT 117 Query: 117 TTGE-STDIIASCTHPEEYKHGVTLPSFAGM---TARNYLERFDAPRESLARVAVKNHRN 172 E +++ + PE+ G T FAG+ A+ Y +R+ ++LA +A KNH+N Sbjct: 118 PGPEIGKNLLKASYLPED---GETPAGFAGVFGKIAQAYFQRYGDQSDALAMIAAKNHKN 174 Query: 173 GVDNPKAQFQKEIDIETALE----SPIIADPLRLYDFCPITDGSAAMMFTTEERAQEITD 228 GVDNP AQ +K+ E + +P +A PL+ D ++DG+AA++ + A + Sbjct: 175 GVDNPYAQMRKDFGYEFCRQESEKNPFVAGPLKRTDCSLVSDGAAALILA--DTATALKM 232 Query: 229 EYAIVSGVGGATDTHVVHERDDPTVMGGVVESSKQAYEMAGVGPDDLDVAELHDMFTILE 288 A+ + + D G ++ +A + AGV DDL E HD FTI E Sbjct: 233 RRAVAFRANEHVQDFLPMSKRDILTFEGCEQAWNRALKSAGVTLDDLSFVETHDCFTIAE 292 Query: 289 FLQLEGIGVADHGAAWELAMDGVTAKDGGLPINTSGGLKSKGHPLGASGVAQGVEIYEQL 348 ++ E +G+A G +LA+DG TAKDG LP+N SGGLK+KGHP+GA+GV+ V QL Sbjct: 293 LIEYEAMGLAKPGEGAKLALDGTTAKDGRLPVNPSGGLKAKGHPIGATGVSMHVLTAMQL 352 Query: 349 VGEAGPRQVE-ADTALACNVGG 369 VGEA QV A N+GG Sbjct: 353 VGEASGIQVPGAKLGGIFNMGG 374 Lambda K H 0.314 0.131 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 388 Length adjustment: 30 Effective length of query: 353 Effective length of database: 358 Effective search space: 126374 Effective search space used: 126374 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory