Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate YP_004144287.1 Mesci_5138 glycine betaine/L-proline ABC transporter ATPase
Query= CharProtDB::CH_001555 (400 letters) >NCBI__GCF_000185905.1:YP_004144287.1 Length = 361 Score = 284 bits (726), Expect = 3e-81 Identities = 146/281 (51%), Positives = 201/281 (71%), Gaps = 5/281 (1%) Query: 3 IKLEIKNLYKIFGEHPQRAFKYIEQGLSKEQILEKT--GLSLGVKDASLAIEEGEIFVIM 60 +KL +N++K+FG + A +I + K + + T GL V+ L I +GEIF+IM Sbjct: 21 VKLACRNVWKLFGSN---AANFIRERDGKASMADVTAAGLVGAVRAVDLEIRQGEIFIIM 77 Query: 61 GLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPH 120 GLSGSGKST+VR ++RL+EPT G+V +G D+ KISDA L E+RR ++ MVFQ+FAL+PH Sbjct: 78 GLSGSGKSTLVRCMSRLVEPTHGKVEFEGNDLLKISDAALIELRRHRMGMVFQNFALLPH 137 Query: 121 MTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALA 180 + VL+N AF + + G + R +A + + VGL H YP ELSGG +QRVG+AR+LA Sbjct: 138 LNVLENIAFPLSIQGQDRATREARAREVIELVGLRGREHFYPRELSGGQQQRVGIARSLA 197 Query: 181 INPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN 240 P+I +DE FSALDPLIR EMQDEL++LQ +TIVFI+HD DEA+R+ DRIAIM++ Sbjct: 198 TKPEIWFLDEPFSALDPLIRREMQDELMRLQMMLHKTIVFITHDFDEAIRLADRIAIMKD 257 Query: 241 GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIAR 281 GEV+Q+GTP+E++ NPA DYV F R VD ++V SA+ + R Sbjct: 258 GEVIQIGTPEELVVNPATDYVAEFTRDVDRAKVISARSLMR 298 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 361 Length adjustment: 30 Effective length of query: 370 Effective length of database: 331 Effective search space: 122470 Effective search space used: 122470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory