Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_013607478.1 SPIBUDDY_RS09180 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000190435.1:WP_013607478.1 Length = 251 Score = 129 bits (325), Expect = 4e-35 Identities = 82/251 (32%), Positives = 135/251 (53%), Gaps = 5/251 (1%) Query: 1 MTLRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVF 60 + LR + T GT K L+++S S+ G+ A++G NG GKSTLL+ L + G V Sbjct: 4 LELRQISYTYPGGT-KALDEISFSVEEGQSVAILGSNGAGKSTLLDIL--LGWNKVGDVS 60 Query: 61 LGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVN 120 L ++ ++L R L+L+PQ T+ E +GR+P+LS G + ED + Sbjct: 61 LFGKDLSSYGRKELGRTLALVPQSEHYNFSFTLLEYTLFGRSPYLSQMGIPTQEDAEIAS 120 Query: 121 VAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRL 180 A+ + + R +T LSGG+ Q LA +AQ + V+LLDEPT+ LD +++ ++ + Sbjct: 121 QALKEVGLAAYEDRPITSLSGGEHQLLLLARAIAQQSKVLLLDEPTSALDPANRMRVINI 180 Query: 181 MGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAE 240 + L QGKT++ HD N A + ++ G ++ GT EE +T +L T++ E Sbjct: 181 LKSLSEQGKTLLFTTHDANLAYELATHVAMLKKGKMLCYGTKEETVTSQMLTTLY--ETP 238 Query: 241 IHPEPVSGRPM 251 +H V G+ + Sbjct: 239 MHVGMVEGKTL 249 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 251 Length adjustment: 24 Effective length of query: 231 Effective length of database: 227 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory