Align Isocitrate dehydrogenase [NADP]; IDH; IDP; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 (characterized)
to candidate WP_013606868.1 SPIBUDDY_RS06035 NADP-dependent isocitrate dehydrogenase
Query= SwissProt::Q9ZH99 (427 letters) >NCBI__GCF_000190435.1:WP_013606868.1 Length = 409 Score = 476 bits (1226), Expect = e-139 Identities = 246/406 (60%), Positives = 303/406 (74%), Gaps = 10/406 (2%) Query: 24 ITVNKAVLEVPDRPIIPFIEGDGIGIDIAPVMKNVVDAAVEKSYAGKRKIEWMEIYAGEK 83 I++ L VPD IP IEGDG+G +I VMKNVVD AV+K+Y G+R I+++E+ AG+K Sbjct: 5 ISIENGKLSVPDHVTIPCIEGDGVGPEITSVMKNVVDQAVQKAYQGRRSIQFIEVLAGQK 64 Query: 84 ATKVYGKDNWLPDETLEAIKEYQVAIKGPLTTPVGGGIRSLNVALRQQLDLYVCLRPVRY 143 A G +LP+ET+EA+ Y+VAIKGPLTTPVG GIRSLNV LRQ LDLYVCLRPV Y Sbjct: 65 AKDTVG--TYLPEETMEAVNTYKVAIKGPLTTPVGKGIRSLNVTLRQSLDLYVCLRPVEY 122 Query: 144 FTGVPSPVKTPEKVNMVIFRENSEDIYAGIEWPAGSPEAVKLINFLQNEMGVKKIRFPET 203 F GVPSPVK PEKV+MV+FREN+EDIYAGIEW AGS K++NFL +EMGVK IRFP + Sbjct: 123 FAGVPSPVKHPEKVDMVVFRENTEDIYAGIEWEAGSSGVQKVLNFLTDEMGVKNIRFPNS 182 Query: 204 AGIGIKPVSKEGTSRLVRRAIQYAIDNDRDSVTLVHKGNIMKFTEGAFKDWGYEVAVKEF 263 + +GIKPVS+EG+ RL+R AI YA++++R +VTLVHKGNIMKFTEG F WGYE+A +EF Sbjct: 183 SALGIKPVSREGSERLIRSAITYALEHNRRNVTLVHKGNIMKFTEGGFNAWGYELAKREF 242 Query: 264 GAKPLDGGPWHVFENPKTGQKITIKDVIADAFLQQILLRPAEYSVIATLNLNGDYISDAL 323 GA+ + VF G+ + I+D I DAFLQ ILL+P Y VIATLNLNGDY+SDAL Sbjct: 243 GAQ--EDAKKRVFIPRTEGEPLYIQDCICDAFLQNILLKPEAYDVIATLNLNGDYVSDAL 300 Query: 324 AAEVGGIGIAPGANLSDTVG--LFEATHGTAPKYAGQDKVNPGSLILSAEMMLRYLGWKE 381 AAEVGGIGIAPGAN++ G +FEATHGTAP AG+D VNP SL+LSA MML YLGW E Sbjct: 301 AAEVGGIGIAPGANINYDNGYAIFEATHGTAPDIAGKDLVNPLSLVLSAVMMLNYLGWDE 360 Query: 382 AADLVVQGIEGAIESKTVTYDFARLMT----GAKEVSTSQFGKAII 423 AA L+ + AIE+ VT DF + M ++ T FG+ ++ Sbjct: 361 AASLIKCAVGKAIEAGAVTSDFYQAMVKEGRACTQLGTQAFGQRLV 406 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 534 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 409 Length adjustment: 32 Effective length of query: 395 Effective length of database: 377 Effective search space: 148915 Effective search space used: 148915 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_013606868.1 SPIBUDDY_RS06035 (NADP-dependent isocitrate dehydrogenase)
to HMM TIGR00183 (icd: isocitrate dehydrogenase, NADP-dependent (EC 1.1.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00183.hmm # target sequence database: /tmp/gapView.3764029.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00183 [M=417] Accession: TIGR00183 Description: prok_nadp_idh: isocitrate dehydrogenase, NADP-dependent Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-178 578.7 0.2 3.6e-178 578.5 0.2 1.0 1 NCBI__GCF_000190435.1:WP_013606868.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000190435.1:WP_013606868.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 578.5 0.2 3.6e-178 3.6e-178 12 414 .. 3 407 .. 1 409 [] 0.96 Alignments for each domain: == domain 1 score: 578.5 bits; conditional E-value: 3.6e-178 TIGR00183 12 ekitlkngklvvpnnpiipyieGdGiGvdivpaaikvldaavekaykgekkiawfevyaGekayelygeeeyl 84 + i+++ngkl vp++ ip ieGdG+G +i++ +++v+d av+kay+g + i+++ev aG+ka + +g +yl NCBI__GCF_000190435.1:WP_013606868.1 3 KAISIENGKLSVPDHVTIPCIEGDGVGPEITSVMKNVVDQAVQKAYQGRRSIQFIEVLAGQKAKDTVG--TYL 73 5799****************************************************************..9** PP TIGR00183 85 pedtldaikeykvaikGplttpvGgGirslnvalrqeldlyvclrpvryykgvpspvkepekvdlvifrente 157 pe+t++a++ ykvaikGplttpvG+Girslnv+lrq ldlyvclrpv y+ gvpspvk+pekvd+v+frente NCBI__GCF_000190435.1:WP_013606868.1 74 PEETMEAVNTYKVAIKGPLTTPVGKGIRSLNVTLRQSLDLYVCLRPVEYFAGVPSPVKHPEKVDMVVFRENTE 146 ************************************************************************* PP TIGR00183 158 diyaGiewaegseeakklikflknelkvkkirlpedsGiGikpiseegtkrlvrkaieyaiendkksvtlvhk 230 diyaGiew++gs +++k+++fl +e++vk+ir+p++s +Gikp+s+eg++rl+r ai+ya+e++++ vtlvhk NCBI__GCF_000190435.1:WP_013606868.1 147 DIYAGIEWEAGSSGVQKVLNFLTDEMGVKNIRFPNSSALGIKPVSREGSERLIRSAITYALEHNRRNVTLVHK 219 ************************************************************************* PP TIGR00183 231 GnimkfteGafkdwGyelakkefgeevitkalwdklknpeeGkkivvkdriadallqqiltrpdeydviatmn 303 GnimkfteG f+ wGyelak+efg++ +a+ + eG+ + ++d i da+lq+il++p+ ydviat+n NCBI__GCF_000190435.1:WP_013606868.1 220 GNIMKFTEGGFNAWGYELAKREFGAQE--DAKKRVFIPRTEGEPLYIQDCICDAFLQNILLKPEAYDVIATLN 290 ************************985..344444455579******************************** PP TIGR00183 304 lnGdylsdalaalvGGlGiapGanigdeva..ifeathGtapkyaGldkvnpgsvilsgvllleflGwkeaad 374 lnGdy+sdalaa vGG+GiapGani+++ + ifeathGtap aG+d vnp s++ls+v++l++lGw eaa NCBI__GCF_000190435.1:WP_013606868.1 291 LNGDYVSDALAAEVGGIGIAPGANINYDNGyaIFEATHGTAPDIAGKDLVNPLSLVLSAVMMLNYLGWDEAAS 363 **************************986555***************************************** PP TIGR00183 375 livkalekaiaskevtydlarlmdg....akevkcsefaeaive 414 li+ a++kai++ vt d+ + m ++++++ f++ +v NCBI__GCF_000190435.1:WP_013606868.1 364 LIKCAVGKAIEAGAVTSDFYQAMVKegraCTQLGTQAFGQRLVA 407 *******************9999543355689999999999885 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (409 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 20.28 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory