Align 4-carboxymuconolactone decarboxylase; CMD; EC 4.1.1.44 (uncharacterized)
to candidate WP_010441730.1 G7G_RS0112310 gamma-carboxymuconolactone decarboxylase
Query= curated2:P20370 (134 letters) >NCBI__GCF_000192475.1:WP_010441730.1 Length = 126 Score = 84.0 bits (206), Expect = 7e-22 Identities = 38/121 (31%), Positives = 70/121 (57%) Query: 3 DEQRYKQGLEVRTEVLGEKHVNRSLENLNDFNQDFQNFISRFAWGEVWSRPGLPRHTRSL 62 DE + +GLE R LG ++V ++L +DF + FQ ++ + WG W + TRS+ Sbjct: 5 DEDLFLKGLEQRKTTLGAEYVEKNLATADDFTRPFQEAMTAWCWGFGWGDDVIDAKTRSM 64 Query: 63 VTIAVLLALGREDELRMHLRACFNNGVTKDELKELILHCSLYAGLPASNAAMHMAEEVFK 122 + ++++ ALG+ E H R NNGVTK+E++ ++ +Y G+P + +A++V + Sbjct: 65 MNLSMIGALGKMTEWETHCRGAINNGVTKEEIRAIVHVIGIYCGVPQALECFRVAKKVLE 124 Query: 123 D 123 + Sbjct: 125 E 125 Lambda K H 0.320 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 49 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 134 Length of database: 126 Length adjustment: 14 Effective length of query: 120 Effective length of database: 112 Effective search space: 13440 Effective search space used: 13440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 41 (20.4 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory