Align 3-oxoadipate CoA-transferase (subunit 1/2) (EC 2.8.3.6) (characterized)
to candidate WP_010441664.1 G7G_RS0111960 CoA transferase subunit B
Query= BRENDA::P0A102 (213 letters) >NCBI__GCF_000192475.1:WP_010441664.1 Length = 208 Score = 208 bits (529), Expect = 7e-59 Identities = 104/204 (50%), Positives = 141/204 (69%), Gaps = 1/204 (0%) Query: 9 RTEMAQRVAADIQEGAYVNLGIGAPTLVANYLGDKEVFLHSENGLLGMGPSPAPGEEDDD 68 R +MA R A ++++G YVNLGIG PTLVANY+GDK++ L SENG+LGMGP P GEED D Sbjct: 5 RNQMAARAAEELEDGMYVNLGIGIPTLVANYVGDKDITLQSENGMLGMGPFPFEGEEDAD 64 Query: 69 LINAGKQHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWHTGAEGSIP 128 LINAGKQ +T L+ ++F A SF+M+RGG + A+LGA +V KGDLANW + + Sbjct: 65 LINAGKQTITELSRTSYFDSATSFAMIRGGKIAAAILGAMEVDEKGDLANWMIPGK-LVK 123 Query: 129 AVGGAMDLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLAVLEVTPEG 188 +GGAMDL G +V V+MDH K G+SK++ ECT PLTG V RI T+L VL+V G Sbjct: 124 GMGGAMDLVAGVGRVIVVMDHTNKHGDSKVLKECTLPLTGQGVVDRIITNLGVLDVVEGG 183 Query: 189 LKVVEICADIDFDELQKLSGVPLI 212 LK+VE+ + +++ + ++ Sbjct: 184 LKIVELADGVSDADMRAATQATIV 207 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 208 Length adjustment: 21 Effective length of query: 192 Effective length of database: 187 Effective search space: 35904 Effective search space used: 35904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory