Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_010438425.1 G7G_RS0103500 SDR family oxidoreductase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2119 (272 letters) >NCBI__GCF_000192475.1:WP_010438425.1 Length = 248 Score = 148 bits (373), Expect = 1e-40 Identities = 91/252 (36%), Positives = 136/252 (53%), Gaps = 6/252 (2%) Query: 18 RLKNKVVLLTGAAQGIGEAIVATFASQQARLIISDIQGEKVEKVAAHWRDQGADVVAIKA 77 RL+ K ++TG A G G IV F S+ AR++I+DI G+ +AA G D ++ + Sbjct: 2 RLEGKTAIVTGGASGFGAGIVQKFLSEGARVMIADINGDAARDMAAAL---GQDAISQQV 58 Query: 78 DVSRQQDLHAMARLAIDLHGRIDVLVNCAGVNVFRDPLE-MTEEDWRRCFAIDLDGAWYG 136 DVS + + AMA + + G +DVLVN AGV PLE ++E D+ R FA+++ + Sbjct: 59 DVSDEDSVQAMADVVQSVFGSLDVLVNNAGVTHMPTPLEEVSEADFDRVFAVNMKSVYLT 118 Query: 137 CKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVN 196 +A +P M +G+G+I+N+AST P Y +K ++ T+ + +E AP GVRVN Sbjct: 119 ARAFVPGMKARGMGAILNVASTAGLSPRPNLNWYNASKGWMITATKTMAVELAPSGVRVN 178 Query: 197 AIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPFIN 256 AI P ET L + D R + P R P ++A A FL SDEA I Sbjct: 179 AICPVAGETPLLKSFMG--EDTPEIRAKFLSTIPLGRFSTPEDMANAACFLCSDEASMIT 236 Query: 257 ASCITIDGGRSV 268 + + +DGGR + Sbjct: 237 GTALEVDGGRCI 248 Lambda K H 0.322 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 248 Length adjustment: 24 Effective length of query: 248 Effective length of database: 224 Effective search space: 55552 Effective search space used: 55552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory