Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_010442691.1 G7G_RS0117200 ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_000192475.1:WP_010442691.1 Length = 362 Score = 293 bits (749), Expect = 7e-84 Identities = 164/366 (44%), Positives = 218/366 (59%), Gaps = 17/366 (4%) Query: 4 IQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDIYIG 63 +++ DL FG+ + +L++DI + EFLVL+G SGCGKST L +AGL T G I+I Sbjct: 8 VEVRDLDLHFGEVKVLQELNIDIHEGEFLVLLGSSGCGKSTLLNCIAGLLDVTDGQIFIK 67 Query: 64 GDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDE---RVVEVAE 120 G ++ ++ P +R I MVFQ YALYP MTV N+ FGL+ RDE RV AE Sbjct: 68 GQNVTWKEPSDRGIGMVFQSYALYPQMTVEGNLSFGLKNAR----VARDEIAKRVARAAE 123 Query: 121 TLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNL 180 L I LL RKP LSGGQ+QRVA+GRA+VRD +VFL DEPLSNLDAKLR ++R EL+ L Sbjct: 124 ILQIEPLLKRKPGALSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRTDLRVELKRL 183 Query: 181 QDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEPMI 240 QL T +YVTH+Q EAMT+ADRIA+M G++ Q+ SP E Y+ P N++VA FIG P + Sbjct: 184 HQQLKNTMIYVTHDQVEAMTLADRIAIMKGGKIMQLGSPDEIYNRPQNIYVAGFIGSPAM 243 Query: 241 NLVRGTRSESTFVGEHFSYPLDEDVMESVDDR-DDFVLGVRPEDIEVADAAPDDAALDDH 299 N++ G F G S PLD E D +G+RPE + DA AA Sbjct: 244 NMIEGRIDNGHFAGHDLSLPLDGYEFERTDHHAGPVAIGIRPEHVLTGDAVETAAA---- 299 Query: 300 DLQMDVTVVEPHGDQNVLHLSHPDQPSADDALQAVTEGMHLVTRGDRVTVTIPPDKIHLF 359 +++V +VE G ++H L+ +G+ VT GDR+ + + LF Sbjct: 300 QAEVEVQIVEKLGSDTLVH-----STLGSLNLRFRMDGLSRVTEGDRLRIGFDTSRASLF 354 Query: 360 DAETGT 365 DA T T Sbjct: 355 DAVTET 360 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 362 Length adjustment: 30 Effective length of query: 353 Effective length of database: 332 Effective search space: 117196 Effective search space used: 117196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory