Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_010442691.1 G7G_RS0117200 ABC transporter ATP-binding protein
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_000192475.1:WP_010442691.1 Length = 362 Score = 299 bits (765), Expect = 9e-86 Identities = 160/346 (46%), Positives = 223/346 (64%), Gaps = 7/346 (2%) Query: 19 GDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRLEDRVLNGVSAQ 78 G++ ++E+++DI +GEFLVL+G SGCGKST L +AGL VT+G++ ++ + + Sbjct: 18 GEVKVLQELNIDIHEGEFLVLLGSSGCGKSTLLNCIAGLLDVTDGQIFIKGQNVTWKEPS 77 Query: 79 DRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVEETTDMLGISDLLDRKPG 138 DR I MVFQSYALYP +V GN+SFGL+ + + DEI +RV ++L I LL RKPG Sbjct: 78 DRGIGMVFQSYALYPQMTVEGNLSFGLKNAR-VARDEIAKRVARAAEILQIEPLLKRKPG 136 Query: 139 QLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQGELGVTTVYVTH 198 LSGGQ+QRVA+GRA+VRD +VFL DEPLSNLDAKLR ++R EL+RL +L T +YVTH Sbjct: 137 ALSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRTDLRVELKRLHQQLKNTMIYVTH 196 Query: 199 DQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFIGEPSMNLFDGSLSGDTFR 258 DQ EAMT+ DR+A++ G++ Q+G+P + Y+RP N++VAGFIG P+MN+ +G + F Sbjct: 197 DQVEAMTLADRIAIMKGGKIMQLGSPDEIYNRPQNIYVAGFIGSPAMNMIEGRIDNGHFA 256 Query: 259 GDGFDYPLSGATRDQLGGASG-LTLGIRPEDVTVGER-RSGQRTFDAEVVVVEPQGNENA 316 G PL G ++ +G + +GIRPE V G+ + + EV +VE G++ Sbjct: 257 GHDLSLPLDGYEFERTDHHAGPVAIGIRPEHVLTGDAVETAAAQAEVEVQIVEKLGSDTL 316 Query: 317 VHLRFVDGDEGTQFTATTTGQSRVEAGDRTTVSFPEDAIHLFDGET 362 VH G +F G SRV GDR + F LFD T Sbjct: 317 VHSTL--GSLNLRF--RMDGLSRVTEGDRLRIGFDTSRASLFDAVT 358 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 362 Length adjustment: 30 Effective length of query: 353 Effective length of database: 332 Effective search space: 117196 Effective search space used: 117196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory