Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_010442404.1 G7G_RS0115760 sugar ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >NCBI__GCF_000192475.1:WP_010442404.1 Length = 260 Score = 195 bits (496), Expect = 7e-55 Identities = 108/249 (43%), Positives = 162/249 (65%), Gaps = 11/249 (4%) Query: 1 MSDLLEI---RDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPD 57 MSD + R + K +G V A+D E+ +GE++A++GDNGAGKS+++K I G PD Sbjct: 1 MSDTTPVVQGRGIVKRYGHVTAIDHSDFELRQGEILAVIGDNGAGKSSIVKAICGATIPD 60 Query: 58 RGDLVFEGKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNK--- 114 G+++ EG+KV F+SP DAR++GIE +YQ LA+ P L I N+F+ RE+ + F+ K Sbjct: 61 EGEILIEGEKVNFSSPIDARNMGIEIVYQQLAMSPALSIADNMFMGREIRKQGFMGKYMR 120 Query: 115 ---KKMMEE--SKKLLDSLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPT 169 + ME+ +KL + + + IN VE LSGGQRQ VAVARA F+ K I+MDEPT Sbjct: 121 QLDRPAMEKFAREKLTELGLMTVQSINQAVETLSGGQRQGVAVARAAAFATKFIIMDEPT 180 Query: 170 AALSVVEARKVLELARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKIIFHKKKEETN 229 AAL V E+RKVLEL ++++ +G+ +++I+HN+ +EVADRI+V GK + ++ Sbjct: 181 AALGVKESRKVLELIQDVRARGIPIILISHNMPHVFEVADRIHVHRLGKRLCTIDPKDYT 240 Query: 230 VEEITEVMT 238 + + MT Sbjct: 241 MSDAVAFMT 249 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 260 Length adjustment: 24 Effective length of query: 227 Effective length of database: 236 Effective search space: 53572 Effective search space used: 53572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory