Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_010442691.1 G7G_RS0117200 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_000192475.1:WP_010442691.1 Length = 362 Score = 424 bits (1090), Expect = e-123 Identities = 224/360 (62%), Positives = 262/360 (72%), Gaps = 5/360 (1%) Query: 3 SVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQIFI 62 SV VRDL L+FG V VL LN+DI GEFLVLLGSSGCGKSTLLNCIAGLLDV+DGQIFI Sbjct: 7 SVEVRDLDLHFGEVKVLQELNIDIHEGEFLVLLGSSGCGKSTLLNCIAGLLDVTDGQIFI 66 Query: 63 KDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEILQ 122 K +NVTW+EP DRGIGMVFQSYALYPQMTVE NLSFGLK A++ EI KRV RA+EILQ Sbjct: 67 KGQNVTWKEPSDRGIGMVFQSYALYPQMTVEGNLSFGLKNARVARDEIAKRVARAAEILQ 126 Query: 123 IQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLHQS 182 I+PLLKRKP LSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLR++LRVE+KRLHQ Sbjct: 127 IEPLLKRKPGALSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRTDLRVELKRLHQQ 186 Query: 183 LKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMNFF 242 LKNTMIYVTHDQ+EA+TLADRIA+MK G I QL P IYN P+N++VAGFIGSP+MN Sbjct: 187 LKNTMIYVTHDQVEAMTLADRIAIMKGGKIMQLGSPDEIYNRPQNIYVAGFIGSPAMNMI 246 Query: 243 RGEVEPKDGRSFVRAGGIAFDVTAYPAHTRLQPGQKVVLGLRPEHVKVDEARDGEPTHQA 302 G ++ ++ + Y V +G+RPEHV +A + Sbjct: 247 EGRID----NGHFAGHDLSLPLDGYEFERTDHHAGPVAIGIRPEHVLTGDAVETAAAQAE 302 Query: 303 V-VDIEEPMGADNLLWLTFAGQSMSVRIAGQRRYPPGSTVRLSFDMGVASIFDAESENRL 361 V V I E +G+D L+ T ++ R+ G R G +R+ FD AS+FDA +E RL Sbjct: 303 VEVQIVEKLGSDTLVHSTLGSLNLRFRMDGLSRVTEGDRLRIGFDTSRASLFDAVTETRL 362 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 362 Length adjustment: 29 Effective length of query: 332 Effective length of database: 333 Effective search space: 110556 Effective search space used: 110556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory