Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate WP_010438517.1 G7G_RS0103680 carbohydrate ABC transporter permease
Query= reanno::Smeli:SMc04257 (305 letters) >NCBI__GCF_000192475.1:WP_010438517.1 Length = 299 Score = 320 bits (819), Expect = 3e-92 Identities = 151/275 (54%), Positives = 203/275 (73%) Query: 31 IVYGTLIVVALYYLLPLYVMIVTSLKGMPEIRVGNIFAPPLEITFEPWVKAWAEACTGLN 90 ++Y L + ALYYL+PL+VM+ TSLK + EIR G++ + P E++F+ W AW+ ACTG+ Sbjct: 25 LLYVLLGLFALYYLMPLFVMLTTSLKSLEEIRTGSLISLPREVSFDAWKTAWSGACTGIQ 84 Query: 91 CDGLSRGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTILIVGAFIPYQVMI 150 C+GL FWNSV I VP+V IS + ++NGY +A WRFKGA++ F++++ G FIP+QV++ Sbjct: 85 CEGLRPYFWNSVLIAVPAVAISTLLGALNGYVVAQWRFKGANIIFSLMLFGCFIPFQVVL 144 Query: 151 YPIVIVLREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELFKAARVDGAGFWTI 210 P+ +L MG+ GT+ GLI VH I+G+ TL FRNY+ +P EL KAARVDGAGF I Sbjct: 145 LPMARLLGIMGIAGTIPGLIFVHVIYGLGFTTLFFRNYYVTIPAELTKAARVDGAGFMRI 204 Query: 211 YFKIMLPMSLPIFVVAMILQVTGIWNDFLFGVVFTRPEYYPMTVQLNNIVNSVQGVKEYN 270 ++ I LP+SLPI VV +I Q T IWNDFLFGV F++ P+TV LNNIVNS GVKEYN Sbjct: 205 FWSIFLPLSLPIIVVTVIWQFTQIWNDFLFGVSFSQAGTQPVTVALNNIVNSTTGVKEYN 264 Query: 271 VNMAATILTGLVPLTVYFVSGRLFVRGIAAGAVKG 305 V+MAA I+ GL L VY V+G+ F+RG+ AG+VKG Sbjct: 265 VDMAAAIIAGLPTLLVYVVAGKYFIRGLTAGSVKG 299 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 299 Length adjustment: 27 Effective length of query: 278 Effective length of database: 272 Effective search space: 75616 Effective search space used: 75616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory