Align CBP protein aka CebG, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate WP_010441522.1 G7G_RS0111295 carbohydrate ABC transporter permease
Query= TCDB::Q9X9R5 (276 letters) >NCBI__GCF_000192475.1:WP_010441522.1 Length = 282 Score = 118 bits (295), Expect = 2e-31 Identities = 84/280 (30%), Positives = 135/280 (48%), Gaps = 14/280 (5%) Query: 5 RQLHAGPVTYVVLTVFALVS-LAPLVWTAI-----AASRTNHRLAETPPPLWFGGNLFKN 58 +Q A ++Y L AL+ L PL+ A+ AA TN P F G N Sbjct: 8 KQPRAAQISYQALLPIALLLWLGPLLAVALFSVKPAADFTNANYWGMPSS--FEGAF--N 63 Query: 59 LEAAWEQAGLGTAMLNSVIVAGTITVSTVLFSTLAGFAFAKLRFRFSGLLLLLTIGTMMI 118 + + + +LNS ++ + V S + GFA +F+ + + + + + Sbjct: 64 YGQVFFNSDMPRYLLNSFLITVPTVIGAVALSCMTGFALGIYKFKSNLWIFFMFVAGNFV 123 Query: 119 PPQLAVVPLYLWMSDLGWSNQLHTVILPSLV--TAFGTFFMRQYLVQALPTELIEAARVD 176 P Q+ +VP+ +LG N ++L + T F T FMR + ++ALP ELIEAARV+ Sbjct: 124 PFQILMVPVRDLTLELGLYNTKTGLVLFHIAFQTGFCTLFMRNF-IRALPFELIEAARVE 182 Query: 177 GASSLRIVWHVVFPAARPAMAVLGLLTFVFAWNDFLWPII-ALNQQNPTVQVGPELARHR 235 G S RI W+VV P +PA+A L +L F F WND+ W ++ ++ V G + Sbjct: 183 GISEWRIFWYVVLPLMKPAIAALSVLIFTFIWNDYFWAVVLTQGAESQPVTAGITSFNAQ 242 Query: 236 VLPDQAVIMAGALLGTLPLLVAFLLFGKQIVGGIMQGAIK 275 ++ AG+++ LP + F L K + G+ GA+K Sbjct: 243 FRAAYQLMSAGSIVAALPPVAMFFLMQKHFIAGLTLGAVK 282 Lambda K H 0.327 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 282 Length adjustment: 26 Effective length of query: 250 Effective length of database: 256 Effective search space: 64000 Effective search space used: 64000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory