Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_010439167.1 G7G_RS0105150 ATP-binding cassette domain-containing protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_000192475.1:WP_010439167.1 Length = 258 Score = 249 bits (636), Expect = 4e-71 Identities = 129/250 (51%), Positives = 174/250 (69%) Query: 15 LLEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQILL 74 ++EI++LHK +G LEVLKGVD+T RG+VV+LIGSSGSGK+TLLRC N+LE+ Q G+IL Sbjct: 7 VIEIKNLHKSFGQLEVLKGVDITAHRGDVVSLIGSSGSGKSTLLRCCNLLEDSQEGEILF 66 Query: 75 DGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLHK 134 GE + + + R K + + R M FQQFNL+ H+T LQNV + V + Sbjct: 67 KGEPVRWTGSHNHRRPADPKQVLRIRTNLSMVFQQFNLWAHMTILQNVMEAPVTVLGRDR 126 Query: 135 DEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPE 194 E A ++LE+VG+ ++ D YP QLSGGQQQR AIAR + M P +LFDE TSALDPE Sbjct: 127 SEVEDSARRYLEKVGIGDKCDVYPAQLSGGQQQRAAIARGLCMEPQALLFDEPTSALDPE 186 Query: 195 LVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQSP 254 L EV+ VIK LA +G TM++VTH+M+ A ++S +VF++QG IEE+G P++LF P+S Sbjct: 187 LEQEVIKVIKDLAAEGRTMIIVTHDMKMAADISSHVVFLHQGLIEEEGLPEDLFTTPESE 246 Query: 255 RLAEFLKNTR 264 RL FL T+ Sbjct: 247 RLQGFLSATQ 256 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 258 Length adjustment: 25 Effective length of query: 240 Effective length of database: 233 Effective search space: 55920 Effective search space used: 55920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory