Align 2-dehydro-3-deoxygluconokinase (EC 2.7.1.45) (characterized)
to candidate WP_010442651.1 G7G_RS0117010 ribokinase
Query= reanno::Cup4G11:RR42_RS28860 (311 letters) >NCBI__GCF_000192475.1:WP_010442651.1 Length = 310 Score = 95.1 bits (235), Expect = 2e-24 Identities = 91/290 (31%), Positives = 124/290 (42%), Gaps = 49/290 (16%) Query: 31 GDTSNFCIAAARQGARAGYISAVGEDTFGERLLALWTQERVDTRHVRIDAGAPTGVYFVT 90 G N +AA R G Y ++G F + + E + + D G V Sbjct: 39 GGGFNAMVAAKRAGMMVFYGGSIGSGPFAKIIREGLNTEGIPFLRAQ-DLTRDQGCCTVM 97 Query: 91 HDAHGHRFDYLRSGSAASHYSHENLPHHAIAEARYLHVSGISLAISTS--------ACDA 142 D G R ++ S A H + E+L + AE + +SG +L + S + DA Sbjct: 98 IDPQGER-TFVASDGAEGHVTAEDLTQISFAEFDWTLLSGYALHYTGSRDALHQRLSSDA 156 Query: 143 GL-----------AAMEHARKAGCQVTLDTNLRLRLWTLARARGIMREAFALTDVCLPSW 191 + A++ H L T LR W A AR Sbjct: 157 RINNLVFDPSPIIASLPHE-------VLQTALRRATWISANAR----------------- 192 Query: 192 DDITVLTGLDDRDAIVDYLLGC--GIGLVALKLGEEGAYVATPEARTLVPPYTVRPVDAT 249 + VLTG D A L G ++LGE+G +A P+A +PPY V+ VD Sbjct: 193 -EAAVLTGHTDPIAAAKALAETRPDDGGTIVRLGEDGCILARPDALHHIPPYRVQAVDTN 251 Query: 250 GAGDCFGGSFVARLAAGDDPFDAARYANVAAALSTTGYG-AVAPIPSIET 298 GAGD GSF+AR+A GD P +AA YANVAAALSTT G A AP ++ T Sbjct: 252 GAGDTHVGSFIARMARGDTPKEAAIYANVAAALSTTQQGPATAPTQAVVT 301 Lambda K H 0.321 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 310 Length adjustment: 27 Effective length of query: 284 Effective length of database: 283 Effective search space: 80372 Effective search space used: 80372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory