Align NAD-dependent glycerol dehydrogenase; Dha-forming NAD-dependent glycerol dehydrogenase; EC 1.1.1.6 (characterized)
to candidate WP_010443330.1 G7G_RS0120430 L-iditol 2-dehydrogenase
Query= SwissProt::Q92EU6 (254 letters) >NCBI__GCF_000192475.1:WP_010443330.1 Length = 257 Score = 139 bits (350), Expect = 6e-38 Identities = 87/251 (34%), Positives = 138/251 (54%), Gaps = 13/251 (5%) Query: 12 ITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLDIK-EDVKDVAAQINPSRTLALQVDIT 70 + K A++TGAA GIG A A+ + +GA V + DI + +D A++I + LA+++D+T Sbjct: 4 LAGKTALITGAARGIGLAFAKAYVTEGARVAIADIDIQRARDAASEIGEA-ALAIEMDVT 62 Query: 71 KKENIEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNLKGSFLMAQII 130 ++I++ VA + IDIL N+A + ++ +D+ ++N+ G+ Q + Sbjct: 63 NLQSIDEAVANTAAHFGLIDILINNAAIFTAAPIVEIERMDYDRVFDINVAGTLFTMQAV 122 Query: 131 GREMIATG-GGKIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAPYNINVNAIS 189 R MI G G+I+NMASQA YCASKAAI+S+TQ ++ Y INVNAI+ Sbjct: 123 ARHMIEKGTRGRIINMASQAGRRGEPLVAIYCASKAAIISLTQSAGLDLISYGINVNAIA 182 Query: 190 PTVILTEL--GKKAW--------AGQVGEDMKKLIPAGRFGYPEEVAACALFLVSDAASL 239 P V+ E G A+ GQ ++ +P GR G +++ A+FL SD A+ Sbjct: 183 PGVVDGEHWDGVDAFFAKHEGKPPGQKKREVAATVPYGRMGRADDLTGMAVFLASDDANY 242 Query: 240 ITGENLIIDGG 250 I + +DGG Sbjct: 243 IVAQTYNVDGG 253 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 257 Length adjustment: 24 Effective length of query: 230 Effective length of database: 233 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory