Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_010438291.1 G7G_RS0103225 ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_000192475.1:WP_010438291.1 Length = 353 Score = 178 bits (451), Expect = 2e-49 Identities = 89/224 (39%), Positives = 142/224 (63%), Gaps = 6/224 (2%) Query: 41 VGLNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALR 100 V +++++L + AGK+ ++G SG GK+T +R I L TSG++ ++ L A Sbjct: 24 VAVDNINLHVEAGKLVTLLGPSGCGKTTTLRMIAGLEMATSGKITIGDRDVTKLPATD-- 81 Query: 101 AFRMRRVSMVFQSFALMPHRTVLQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKF 160 R VSMVFQS+AL PH +VL+NV+YG G +KD+AR + ++ VGL G+D + Sbjct: 82 ----RDVSMVFQSYALFPHMSVLENVMYGLTFSGFAKDEARSRALDGLELVGLKGFDGRL 137 Query: 161 PHQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFI 220 P +LSGG +QRV +ARAL + V+L DE S LD +R +++ + +Q++L T+V++ Sbjct: 138 PSELSGGQQQRVAVARALVLEPQVLLFDEPLSNLDAKLRRQVREDIRAIQQDLGLTVVYV 197 Query: 221 THDLDEALRIGSEIAILRDGQVVQVGTPNDILDNPANDYVARFV 264 THD +EAL + EI ++R+ + Q+GTP + D P + +VA F+ Sbjct: 198 THDQEEALAVSDEIVVMRNAAIAQIGTPRQLYDAPNDRFVADFI 241 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 353 Length adjustment: 27 Effective length of query: 248 Effective length of database: 326 Effective search space: 80848 Effective search space used: 80848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory