Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_010442422.1 G7G_RS0115845 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_000192475.1:WP_010442422.1 Length = 342 Score = 273 bits (697), Expect = 5e-78 Identities = 143/268 (53%), Positives = 194/268 (72%), Gaps = 1/268 (0%) Query: 3 NAAISKIEVKNVFKIFGNRSKEALELIRQNKTKDQVLAETGCVVGVNDLSLSIGTGEIFV 62 +A I +NV+K+FG + L+ + ++ D++ A+ G + GV D+S+ +G GE+ V Sbjct: 2 SATAPVISAQNVWKLFGPSPESYLKSMPAGRSFDEIRAD-GYIAGVKDVSIEVGRGEMLV 60 Query: 63 IMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREFRRHKISMVFQSFGLL 122 IMGLSGSGKSTLVR F+RL D T G I VDG+DI+ L L E RR+K+ MVFQSFGLL Sbjct: 61 IMGLSGSGKSTLVRCFSRLHDITGGTIKVDGQDIMGLSERDLIELRRNKMGMVFQSFGLL 120 Query: 123 PHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGLKGYENKYPHQLSGGMRQRVGLARA 182 PH++VLDNVA+ L++RG+ + ERAL I VGL+G E +P +LSGG +QRVG+AR+ Sbjct: 121 PHRTVLDNVAFPLEMRGQDRHDRRERALEVIKLVGLEGREEYFPRELSGGQQQRVGIARS 180 Query: 183 LAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIGNRIAIL 242 LA + DI +DE FSALDPLIR EMQD+ L LQ+ L KTIVFITHD DEA+R+ +RIAI+ Sbjct: 181 LAIEPDIWFLDEPFSALDPLIRREMQDEFLRLQEMLGKTIVFITHDFDEALRLADRIAIM 240 Query: 243 KDGKLIQVGTPREILHSPADEYVDRFVQ 270 ++G + Q TP +I+ +PA EYV +F + Sbjct: 241 RNGAVEQCDTPDQIVMNPATEYVAKFTE 268 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 342 Length adjustment: 27 Effective length of query: 249 Effective length of database: 315 Effective search space: 78435 Effective search space used: 78435 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory