GapMind for catabolism of small carbon sources

 

Alignments for a candidate for mcm-small in Ruegeria conchae TW15

Align methylmalonyl-CoA mutase (subunit 1/2) (EC 5.4.99.2) (characterized)
to candidate WP_010441942.1 G7G_RS0113370 methylmalonyl-CoA mutase

Query= BRENDA::A4YIE3
         (155 letters)



>NCBI__GCF_000192475.1:WP_010441942.1
          Length = 708

 Score =  110 bits (274), Expect = 6e-29
 Identities = 57/126 (45%), Positives = 80/126 (63%)

Query: 19  KRIKVVVAKLGLDGHDRGAKVIARALKDAGMEVVYTGLRQTPEQIVRTAIQEDADVIGIS 78
           +R +++V K+G DGHDRGAKVIA A  D G +V    L QTP +  + A+  D  VIGIS
Sbjct: 577 RRPRLLVVKMGQDGHDRGAKVIATAFADIGFDVDVGPLFQTPAEAAQDAVDNDVHVIGIS 636

Query: 79  ILSGAHLELMPKIVEALKKAGLDDVGLVLGGVIPPEDIPKLKAMGVDDVFLPGTSLKEIA 138
             +  H  L P++VE LKKAG +D+ ++ GGVIP +D   L   GV  +F PGT++ + A
Sbjct: 637 SQAAGHKTLAPQLVEELKKAGAEDIIVICGGVIPQQDYQFLYDHGVKAIFGPGTNIPDAA 696

Query: 139 QRVSKL 144
           Q + +L
Sbjct: 697 QDILRL 702


Lambda     K      H
   0.319    0.140    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 217
Number of extensions: 13
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 155
Length of database: 708
Length adjustment: 28
Effective length of query: 127
Effective length of database: 680
Effective search space:    86360
Effective search space used:    86360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory