Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_010443262.1 G7G_RS0120085 acetyl-CoA carboxylase biotin carboxylase subunit
Query= metacyc::MONOMER-13597 (509 letters) >NCBI__GCF_000192475.1:WP_010443262.1 Length = 449 Score = 385 bits (989), Expect = e-111 Identities = 202/443 (45%), Positives = 282/443 (63%), Gaps = 5/443 (1%) Query: 4 FSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYL 63 F ++L+ANRGEIA RV++A +EMG+ +AV+S AD A+H + ADE+ IG P+ SYL Sbjct: 2 FDKILIANRGEIALRVIRAAREMGIKTVAVHSTADSDAMHVRMADESVCIGPPPSPQSYL 61 Query: 64 NIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKR 123 ++ II A E AIHPGYGFLSENAEF + VE GITFIGP++E +R + DK+ K Sbjct: 62 SVPAIISACEITGAQAIHPGYGFLSENAEFVQIVEDHGITFIGPTAEHIRVMGDKITAKD 121 Query: 124 LANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVW 183 GVP PGS+G V ++++A ++ E+ GYP+++KA +GGGG G+ D++ + Sbjct: 122 TMKELGVPCVPGSNGGVPTLEDAKRIGEEFGYPVIIKATAGGGGRGMKVAMTADEMESAF 181 Query: 184 ERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEE 243 + AFG +++IEKY PRHIE Q+ GD G V ER+C++QRR+QK+ EE Sbjct: 182 MTARAEGKAAFGNDEVYIEKYLTTPRHIEIQVFGDGKGKAVHLGERDCSLQRRHQKVFEE 241 Query: 244 APSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTT 303 AP P + EER + + INY GT E + + +FYF+E+N RLQVEHP T Sbjct: 242 APGPCITPEERAKIGKVCADAVAKINYIGAGTIEFLYE--NGEFYFIEMNTRLQVEHPVT 299 Query: 304 ELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVTYY 363 E IF +DLV+ QI +AAGE + F Q+DL + G AIE RINAE L NF+ G +T Y Sbjct: 300 EGIFGVDLVREQILVAAGEDMSFGQDDL--EINGHAIEVRINAE-KLPNFSPCPGKITAY 356 Query: 364 REPTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIGGIKTT 423 P G GVR+DS + G +PPYYDSL++KLIV G R A+ RAL + + GI TT Sbjct: 357 HAPGGLGVRMDSALYDGYSIPPYYDSLIAKLIVQGRDRAEALARLERALGELIVDGIDTT 416 Query: 424 IELYKWIMQDPDFQEGKFSTSYI 446 + L+ ++Q+PD G ++ ++ Sbjct: 417 VPLFHALLQEPDLHSGDYNIHWL 439 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 588 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 449 Length adjustment: 34 Effective length of query: 475 Effective length of database: 415 Effective search space: 197125 Effective search space used: 197125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory