Align glucose transporter, ATPase component (characterized)
to candidate WP_010442404.1 G7G_RS0115760 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF3641 (260 letters) >NCBI__GCF_000192475.1:WP_010442404.1 Length = 260 Score = 184 bits (467), Expect = 2e-51 Identities = 103/250 (41%), Positives = 151/250 (60%), Gaps = 7/250 (2%) Query: 13 TPLVEMKDISISFGGIKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQMDAGEI 72 TP+V+ + I +G + A+DH +L GE++ ++G NGAGKS+++K + GA D GEI Sbjct: 5 TPVVQGRGIVKRYGHVTAIDHSDFELRQGEILAVIGDNGAGKSSIVKAICGATIPDEGEI 64 Query: 73 RVNGDKVEITNPRDARSHNIETIYQTLALADNLDAASNLFLGRELVTP------FGLVDD 126 + G+KV ++P DAR+ IE +YQ LA++ L A N+F+GRE+ +D Sbjct: 65 LIEGEKVNFSSPIDARNMGIEIVYQQLAMSPALSIADNMFMGREIRKQGFMGKYMRQLDR 124 Query: 127 SAMEAECRKIMNRLN-PNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAALG 185 AME R+ + L Q ++ V LSGGQRQ VA+ARA F K +IMDEPTAALG Sbjct: 125 PAMEKFAREKLTELGLMTVQSINQAVETLSGGQRQGVAVARAAAFATKFIIMDEPTAALG 184 Query: 186 PHETQMVAELIQQLKAQGIGIFLIDHDVNAVMELCDRASVMKNGQLVGTVDIDDVTDDDL 245 E++ V ELIQ ++A+GI I LI H++ V E+ DR V + G+ + T+D D T D Sbjct: 185 VKESRKVLELIQDVRARGIPIILISHNMPHVFEVADRIHVHRLGKRLCTIDPKDYTMSDA 244 Query: 246 LSMIILGKRP 255 ++ + K P Sbjct: 245 VAFMTGAKEP 254 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 260 Length adjustment: 24 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory