Align pipecolate oxidase (EC 1.5.3.7) (characterized)
to candidate WP_010441035.1 G7G_RS0110025 FAD-binding oxidoreductase
Query= metacyc::G1G01-5614-MONOMER (432 letters) >NCBI__GCF_000192475.1:WP_010441035.1 Length = 423 Score = 302 bits (774), Expect = 1e-86 Identities = 162/413 (39%), Positives = 230/413 (55%), Gaps = 1/413 (0%) Query: 11 QCLWEHVSKPTVAAQALAGEHKADVCVIGGGITGLSAAIHLLEQGKSVIVLEAWKIGHGG 70 Q LW ++ Q L+G+ D+ VIGGG TG SAA+ + G SV +LEA +IGHGG Sbjct: 6 QSLWRQTCGESIKTQKLSGDVTVDIAVIGGGYTGCSAALTAAKAGASVCLLEAHEIGHGG 65 Query: 71 SGRNVGLVNAGTWIRPDDVEATLGQKQGSRLNKVLGEAPAEVFAMIERLGIDCQAQHKGT 130 SGRNVGLVNAG W+ PD + + LGQ G+RL +L AP+EVF +I+ I C+ GT Sbjct: 66 SGRNVGLVNAGLWLPPDQIRSHLGQVPGNRLIDLLANAPSEVFGLIDAHEIACEPVRHGT 125 Query: 131 LHMAHNATGIADLEARHEQWRRRGADVELLTGAQCQEYCGTDKISAALLDRRAGTINPMG 190 LH AH+A G DL RH Q GA VELL ++ G+ + AL D RAGTI P+ Sbjct: 126 LHCAHSAKGFEDLHTRHSQLSVSGAPVELLDANTSRKRTGSPAVHGALFDPRAGTIQPLA 185 Query: 191 YTQGLAAAVTRLGGKIFQQSSVEGLEREGDGWRVKTARGAVRAEKVVISTGAYTEGDWSN 250 + GLA A G I+ S ++ L +E W + G VRA+ ++ +T AY +G ++ Sbjct: 186 FVVGLARAAQDAGALIYTDSPIQSLRQEAGMWVLHGENGTVRAKSIIQATNAYHQG-IAD 244 Query: 251 LQKQFFRGYYYQVASKPLQGIAADKVLPHGQGSWDTRTVLSSIRRDDQGRLLLGSLGRVD 310 + YY+Q A+ PL +LP G+G WDT +++S R D +GR ++G +G ++ Sbjct: 245 TAPAYVPVYYFQYATAPLSHNLRASILPEGEGCWDTGLIMTSFRLDQEGRFIIGGMGDLN 304 Query: 311 NKPAWFVRSWADRIQSHYYPELGKVEWEMHWTGCIDFTPDHLMRLFEPAPGLVAVTGYNG 370 + + ++W R YP+L W G I T DH+ ++ + P +A G++G Sbjct: 305 SVGGFAHKAWVSRKLVVLYPQLADQPLVEGWHGRIAMTSDHIPKIIQIGPNALAAHGFSG 364 Query: 371 RGNTTGTVIGRAFAEFLLKGEADSLPIPFSPMSGVSAPSLRTAFYESGFSLYH 423 RG GTV GR AE LL + LP+P S LR AF+E+G +L H Sbjct: 365 RGIGPGTVFGRLMAESLLNDDPSLLPVPPITEYCESWTGLRRAFFETGAALTH 417 Lambda K H 0.319 0.135 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 423 Length adjustment: 32 Effective length of query: 400 Effective length of database: 391 Effective search space: 156400 Effective search space used: 156400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory