Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_010438520.1 G7G_RS0103685 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_000192475.1:WP_010438520.1 Length = 365 Score = 383 bits (984), Expect = e-111 Identities = 207/363 (57%), Positives = 251/363 (69%), Gaps = 4/363 (1%) Query: 4 LELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGGAIM 63 L++ + K YG + LK+I +SI+ G+FL+LVGPSGCGKSTL+NCIAGLE ITGG + Sbjct: 5 LDINKLYKNYGP--VEILKDINISIEPGDFLVLVGPSGCGKSTLLNCIAGLEEITGGTLS 62 Query: 64 IGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVAKLL 123 IG D++ +SPKDRDIAMVFQSYALYPTMSV +NI FG+K+R + QA DA++ VA LL Sbjct: 63 IGGNDMTHVSPKDRDIAMVFQSYALYPTMSVAKNITFGMKVRGVDQATQDAKLKEVASLL 122 Query: 124 QIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMHQ 183 QIE LLNR+P QLSGGQ+QRVAMGRAL R PK++LFDEPLSNLDAKLRVEMRTE+K +HQ Sbjct: 123 QIEPLLNRRPSQLSGGQRQRVAMGRALVRDPKLFLFDEPLSNLDAKLRVEMRTEIKKLHQ 182 Query: 184 RLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPPMNF 243 L + VYVTHDQIEAMTL K+ V+K GI+QQ GTP EIYNNPAN FVA F+GSP MN Sbjct: 183 TLDASIVYVTHDQIEAMTLATKIVVLKGGIVQQIGTPAEIYNNPANLFVADFMGSPAMNL 242 Query: 244 VPLRLQRKDGRLVALLDSGQARCELALNTTEAGLEDRDVILGLRPEQIMLAA-GEGDSAS 302 +P + +G + + + L L A +DVILGLRPE I A G Sbjct: 243 IPAQAS-NNGSGTQISITRETGDTLVLTDARAPELPQDVILGLRPEDIAEAGFRAGAGVQ 301 Query: 303 SIRAEVQVTEPTGPDTLVFVQLNDTKVCCRLAPDVAPQVGETLTLQFDPSKVLLFDANTG 362 V + EP G DT V +L +V RL + + Q G+ L L FD SKV F TG Sbjct: 302 EAACMVDMVEPAGADTYVVSELGGKQVTARLHAETSAQAGQMLNLAFDMSKVSYFAKETG 361 Query: 363 ERL 365 ERL Sbjct: 362 ERL 364 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 365 Length adjustment: 30 Effective length of query: 356 Effective length of database: 335 Effective search space: 119260 Effective search space used: 119260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory