Align MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized)
to candidate WP_010442382.1 G7G_RS0115650 ABC transporter ATP-binding protein
Query= TCDB::Q9X103 (369 letters) >NCBI__GCF_000192475.1:WP_010442382.1 Length = 349 Score = 320 bits (821), Expect = 3e-92 Identities = 174/362 (48%), Positives = 234/362 (64%), Gaps = 19/362 (5%) Query: 3 MAQVVLENVTKVYENKVVAVKNANLVVEDKEFVVLLGPSGCGKTTTLRMIAGLEEITDGK 62 MA++ L NV K + V V N +L + DKEF+VLLGPSGCGKTTT+RMIAGLE+ ++G Sbjct: 1 MAEIQLRNVGKRW-GSFVGVDNFDLTIADKEFLVLLGPSGCGKTTTMRMIAGLEDASEGD 59 Query: 63 IYIDGKVVNDVEPKDRDIAMVFQNYALYPHMTVYENMAFGLKLRKYPKDEIDRRVREAAK 122 I IDG VND+EPKDRD+AMVFQ+YALYP+M VYEN+ F LK+R D +VR A+ Sbjct: 60 ILIDGARVNDMEPKDRDVAMVFQSYALYPNMNVYENIRFPLKVRGIDPATHDEKVRRASA 119 Query: 123 ILGIENLLDRKPRQLSGGQRQRVAVGRAIVRNPKVFLFDEPLSNLDAKLRVQMRSELKKL 182 ++ +++ L RKP +LSGGQRQRVA+ RAIVR P VFL DEPLSNLDAKLRV R+++K L Sbjct: 120 MVELDDFLHRKPAELSGGQRQRVALARAIVREPNVFLMDEPLSNLDAKLRVSTRAQIKNL 179 Query: 183 HHRLQATIIYVTHDQVEAMTMADKIVVMKDGEIQQIGTPHEIYNSPANVFVAGFIGSPPM 242 H L T IYVTHDQ+EAMT+AD++V+MK G +QQ+G+P +IY+ PAN FVA FIG+P M Sbjct: 180 SHELAVTTIYVTHDQIEAMTLADRVVIMKQGVVQQVGSPTDIYDEPANTFVASFIGNPAM 239 Query: 243 NFVNARVVRGEGGLWIQASGFKVKVPKEFEDKLANYIDKEIIFGIRPEDIYDKLFALAPS 302 N V+ V +GG++ + E + N D I G R ED A Sbjct: 240 NLVDGDV---KGGVF---------RARNTEVQGLNAPDGPITLGFRAED------ANVVE 281 Query: 303 PENTITGVVDVVEPLGSETILHVKVGDDLIVASVNPRTQAKEEQKIDLVLDMTRMHAFDK 362 I + E LG T++ V++G L+ + +A+ + ++ + + H FD Sbjct: 282 SGGEINAPIYTQELLGDSTMVSVRIGGALVSVKADKTYRAEIDDQVSIHIHTDHCHLFDA 341 Query: 363 ET 364 +T Sbjct: 342 QT 343 Lambda K H 0.319 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 349 Length adjustment: 29 Effective length of query: 340 Effective length of database: 320 Effective search space: 108800 Effective search space used: 108800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory