Align Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate WP_010441522.1 G7G_RS0111295 carbohydrate ABC transporter permease
Query= TCDB::Q72KX4 (268 letters) >NCBI__GCF_000192475.1:WP_010441522.1 Length = 282 Score = 146 bits (368), Expect = 5e-40 Identities = 88/274 (32%), Positives = 145/274 (52%), Gaps = 18/274 (6%) Query: 3 RALLYGFLLLMAGFFLLPVYLVVLTALKEPARITLETVWQWPHPPYWESFRTAWEAFRPK 62 +ALL LLL G P+ V L ++K A T W P SF A+ + Sbjct: 18 QALLPIALLLWLG----PLLAVALFSVKPAADFTNANYWGMP-----SSFEGAFNYGQVF 68 Query: 63 FQ--------NSVVLAVSATLLSALVGSLNGYVLAKWPFRGSGLLFALILFGMFIPYQSI 114 F NS ++ V + + + + G+ L + F+ + +F + + G F+P+Q + Sbjct: 69 FNSDMPRYLLNSFLITVPTVIGAVALSCMTGFALGIYKFKSNLWIFFMFVAGNFVPFQIL 128 Query: 115 LIPLFQFMKSIGLYGSLFGLVLVHVIYGIPIVTLIFRNYYSEIPDELVEAARIDGAGFFG 174 ++P+ +GLY + GLVL H+ + TL RN+ +P EL+EAAR++G + Sbjct: 129 MVPVRDLTLELGLYNTKTGLVLFHIAFQTGFCTLFMRNFIRALPFELIEAARVEGISEWR 188 Query: 175 IFRHVILPLSVPAFVVVAIWQFTQIWNEFLFAVTLTR-PESQPITVALAQLAGGEAVKWN 233 IF +V+LPL PA +++ FT IWN++ +AV LT+ ESQP+T + + Sbjct: 189 IFWYVVLPLMKPAIAALSVLIFTFIWNDYFWAVVLTQGAESQPVTAGITSFNAQFRAAYQ 248 Query: 234 LPMAGAILAALPTLLVYILLGRYFLRGLLAGSVK 267 L AG+I+AALP + ++ L+ ++F+ GL G+VK Sbjct: 249 LMSAGSIVAALPPVAMFFLMQKHFIAGLTLGAVK 282 Lambda K H 0.330 0.146 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 282 Length adjustment: 25 Effective length of query: 243 Effective length of database: 257 Effective search space: 62451 Effective search space used: 62451 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory