Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_010439905.1 G7G_RS0106810 enoyl-CoA hydratase
Query= BRENDA::P77467 (262 letters) >NCBI__GCF_000192475.1:WP_010439905.1 Length = 258 Score = 217 bits (552), Expect = 2e-61 Identities = 117/260 (45%), Positives = 159/260 (61%), Gaps = 5/260 (1%) Query: 3 EFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCA 62 E IL + + LTLNRP+++N+ +M A++ +K+ R R ++LTGAG FC+ Sbjct: 4 EAILLDITDDLAVLTLNRPDKMNALTTQMRAEITYAMKEAARH--ARAIVLTGAGPAFCS 61 Query: 63 GQDLNDRNVDPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGD 122 GQDL D + TG DL ++ Y P++ + P P I AVNG AAGAGA LAL D Sbjct: 62 GQDLGDAS--STGKI-DLERALRDEYEPMLEAVYDCPVPTIAAVNGAAAGAGANLALCAD 118 Query: 123 IVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMGLALLGNQLSAEQAHEWGMIW 182 +VIA SA F+ AF+++GL+PD GGTW +PR G A+AMG AL +++SA QA +WG+IW Sbjct: 119 VVIATESAYFLQAFARIGLLPDAGGTWFMPRQMGFAKAMGAALFADKISARQADDWGLIW 178 Query: 183 QVVDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLDTQLDLERDYQRLAGRSA 242 + V D+ ++ A +LA PT G IKQAI TL QL E Q GR+ Sbjct: 179 EAVSDDQFDAHWRERATYLANGPTAGFRAIKQAIRGTYDRTLPKQLAAEAHLQGECGRTR 238 Query: 243 DYREGVSAFLAKRSPQFTGK 262 D+ EGV AFL KRSP+F G+ Sbjct: 239 DFAEGVVAFLEKRSPKFEGR 258 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 258 Length adjustment: 24 Effective length of query: 238 Effective length of database: 234 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory