Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_010442657.1 G7G_RS0117040 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_000192475.1:WP_010442657.1 Length = 349 Score = 286 bits (733), Expect = 3e-82 Identities = 140/262 (53%), Positives = 193/262 (73%), Gaps = 1/262 (0%) Query: 4 IEIRNVYKIFGHDAKKALTMVE-DGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMGLS 62 I+ + V+K+FG +++AL + +GL K ++L C VG+ D S +I G++F +MGLS Sbjct: 7 IDAKGVWKVFGARSQEALQAIHSEGLSKTEVLEHFDCVVGVADASFEIERGELFCVMGLS 66 Query: 63 GSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPHRTV 122 GSGKSTLVRH+NRL+EPT G + DG++++ L ++LR R RRV+MVFQ+F LMPHRTV Sbjct: 67 GSGKSTLVRHVNRLLEPTDGHIYLDGEDVMGLNDESLRDLRNRRVAMVFQNFGLMPHRTV 126 Query: 123 LQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAADT 182 NV +RG K E + ++ V L+G++ K+ H+LSGGM+QRVGLARA+AAD Sbjct: 127 RDNVAMPLEIRGTGKARRWEEADRVLELVELNGWEDKYAHELSGGMQQRVGLARAIAADP 186 Query: 183 DVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRDGQV 242 +++LMDE FSALDPLIR +QDQ + L L KT +FITHDLDEA+RIG IAI++DG++ Sbjct: 187 EILLMDEPFSALDPLIRKQLQDQFMDLSHKLNKTTMFITHDLDEAIRIGHRIAIMKDGRI 246 Query: 243 VQVGTPNDILDNPANDYVARFV 264 VQ+GTP +I+ NPA+DYVA FV Sbjct: 247 VQIGTPEEIILNPADDYVADFV 268 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 349 Length adjustment: 27 Effective length of query: 248 Effective length of database: 322 Effective search space: 79856 Effective search space used: 79856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory