Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate WP_010442422.1 G7G_RS0115845 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= CharProtDB::CH_001555 (400 letters) >NCBI__GCF_000192475.1:WP_010442422.1 Length = 342 Score = 280 bits (717), Expect = 3e-80 Identities = 144/277 (51%), Positives = 195/277 (70%), Gaps = 1/277 (0%) Query: 5 LEIKNLYKIFGEHPQRAFKYIEQGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSG 64 + +N++K+FG P+ K + G S ++I G GVKD S+ + GE+ VIMGLSG Sbjct: 8 ISAQNVWKLFGPSPESYLKSMPAGRSFDEI-RADGYIAGVKDVSIEVGRGEMLVIMGLSG 66 Query: 65 SGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVL 124 SGKST+VR +RL + T G + +DG DI +S+ +L E+RR K+ MVFQSF L+PH TVL Sbjct: 67 SGKSTLVRCFSRLHDITGGTIKVDGQDIMGLSERDLIELRRNKMGMVFQSFGLLPHRTVL 126 Query: 125 DNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALAINPD 184 DN AF +E+ G + +RRE+AL+ ++ VGLE +P ELSGG +QRVG+AR+LAI PD Sbjct: 127 DNVAFPLEMRGQDRHDRRERALEVIKLVGLEGREEYFPRELSGGQQQRVGIARSLAIEPD 186 Query: 185 ILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVV 244 I +DE FSALDPLIR EMQDE ++LQ +TIVFI+HD DEA+R+ DRIAIM+NG V Sbjct: 187 IWFLDEPFSALDPLIRREMQDEFLRLQEMLGKTIVFITHDFDEALRLADRIAIMRNGAVE 246 Query: 245 QVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIAR 281 Q TPD+I+ NPA +YV F +D ++V AK +A+ Sbjct: 247 QCDTPDQIVMNPATEYVAKFTEDIDKARVVHAKGLAK 283 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 21 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 342 Length adjustment: 30 Effective length of query: 370 Effective length of database: 312 Effective search space: 115440 Effective search space used: 115440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory