Align methylmalonyl-CoA mutase (subunit 1/2) (EC 5.4.99.2) (characterized)
to candidate WP_010442843.1 G7G_RS0117980 protein meaA
Query= BRENDA::O58013 (147 letters) >NCBI__GCF_000192475.1:WP_010442843.1 Length = 655 Score = 115 bits (287), Expect = 2e-30 Identities = 55/114 (48%), Positives = 80/114 (70%), Gaps = 3/114 (2%) Query: 9 KVRVLVAKPGLDGHDRGAKVVARALRDAGYEVIYTGIRQTPEQIVEAVIEEDVDVLGISI 68 +++ LV KPGLDGH GA+ +A RD G ++ Y GIR TPE+IV AV E + V+G+SI Sbjct: 521 RLKFLVGKPGLDGHSNGAEQIAFRARDCGMDISYEGIRLTPEEIVSAVQETNAHVIGLSI 580 Query: 69 LSGAHMVLIPKILKLLEEKGIKVNEDVLVVAGGIIPPDDAEELKKMGVAEVFGP 122 LSG+H+ L+ ++ L E G+ D+ V+ GGIIP +DAE+L+ MGVA+++ P Sbjct: 581 LSGSHLPLVKDVMTRLTEAGL---SDIPVIVGGIIPDEDAEQLRSMGVAKIYTP 631 Lambda K H 0.318 0.140 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 147 Length of database: 655 Length adjustment: 27 Effective length of query: 120 Effective length of database: 628 Effective search space: 75360 Effective search space used: 75360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory