Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_010443330.1 G7G_RS0120430 L-iditol 2-dehydrogenase
Query= reanno::Phaeo:GFF1301 (257 letters) >NCBI__GCF_000192475.1:WP_010443330.1 Length = 257 Score = 384 bits (985), Expect = e-111 Identities = 192/257 (74%), Positives = 221/257 (85%) Query: 1 MKRLSGKRALITGAARGIGAAFAEAYANEGARVVIADIDTARAEATAAQIGAAAIAVELD 60 M RL+GK ALITGAARGIG AFA+AY EGARV IADID RA A++IG AA+A+E+D Sbjct: 1 MTRLAGKTALITGAARGIGLAFAKAYVTEGARVAIADIDIQRARDAASEIGEAALAIEMD 60 Query: 61 VTDQASIDRALSRTVECFGGLDILINNAAVFTAAPLVEVTREAYQRTFDINVSGTLFMMQ 120 VT+ SID A++ T FG +DILINNAA+FTAAP+VE+ R Y R FDINV+GTLF MQ Sbjct: 61 VTNLQSIDEAVANTAAHFGLIDILINNAAIFTAAPIVEIERMDYDRVFDINVAGTLFTMQ 120 Query: 121 AAAQQMITQGTGGKIINMASQAGRRGEPLVSVYCATKAAVISLTQSAGLNLISHGINVNA 180 A A+ MI +GT G+IINMASQAGRRGEPLV++YCA+KAA+ISLTQSAGL+LIS+GINVNA Sbjct: 121 AVARHMIEKGTRGRIINMASQAGRRGEPLVAIYCASKAAIISLTQSAGLDLISYGINVNA 180 Query: 181 IAPGVVDGEHWDGVDAFFAKYEGKAPGQKKAEVAQSVPYGRMGTAADLTGMAVFLASEDA 240 IAPGVVDGEHWDGVDAFFAK+EGK PGQKK EVA +VPYGRMG A DLTGMAVFLAS+DA Sbjct: 181 IAPGVVDGEHWDGVDAFFAKHEGKPPGQKKREVAATVPYGRMGRADDLTGMAVFLASDDA 240 Query: 241 DYVVAQTYNVDGGQWMS 257 +Y+VAQTYNVDGG WMS Sbjct: 241 NYIVAQTYNVDGGNWMS 257 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 257 Length adjustment: 24 Effective length of query: 233 Effective length of database: 233 Effective search space: 54289 Effective search space used: 54289 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory